Protein Family IF08618

Metagenome Isolate
142 Members
37 Samples
123 Scaffolds
396.7 Avg Length

🧬 Representative Sequence

ID
3300042622|Ga0466731_323752|Ga0466731_323752_2673_3953
Length
426 aa
Sequence
MFLNNGKKSSFYLVKYAIVNYQKIKETKMLYTQGKTDCTPGEIGYDENRLQVLNNHFQKLINDGEIQCGTYCVSRKGRIFAHGAVGKKSFRKDDNTPVQPDSVRWIASITKVITAAAIMKLVEDGITRLDIPVAEILPQFNTPPYNGITLFQLLTHTSGMHTDDGCFDNKYQLNYWSLIEGKYKLHNPEKDGEFDWIAASLGVVGNGLRVKPDTEWGYCSFGYVILGAVIEKLTGINAHKYIEDNICKPLGMKDTLFDPTPEMAKRYIITEEDDEKWMNDVINGTYEPEWIGEKLKIPGTGGSLNGTPYDLIRFGNMMLFNGTFDGVRVLGKKAVEKMTTIAVDYPNNCWNANEKQRFYGVGFDMRNGPQFTYSQGTYMHEGAGACSLYIDPKEELVAAWIVPYAKEGWWPRALFNVHNIIWSGIK

📊 Sample Types

Isolate 9.2%
Metagenome 90.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 64.7%
Unclassified 35.3%

🌳 Taxonomy

Archaea 1
Bacteria 127
Eukaryota 0
Viruses 0
Unclassified 14

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2228664003 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA Metagenome Termitidae
2 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
3 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
4 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
5 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
6 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
7 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
8 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
9 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
10 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
11 2820490862 Unclassified Firmicutes Lab288P1bin64 Isolate Unclassified
12 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
13 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
14 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
15 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
16 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
17 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
18 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
19 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
20 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
21 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
22 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
23 2820615445 Unclassified Firmicutes Emb289P1bin132 Isolate Unclassified
24 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
25 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
26 2820373881 Unclassified Firmicutes Nt197P3bin10 Isolate Unclassified
27 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
28 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
29 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
30 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
31 2820244222 Unclassified Firmicutes Th196P3bin75 Isolate Unclassified
32 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
33 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
34 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
35 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
36 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
37 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123356_10005073 3300010049 Bacteria 13501
2 Ga0123356_10169590 3300010049 Unclassified 2191
3 Ga0123353_10143538 3300010167 Bacteria 3821
4 Ga0466712_027405 3300042614 Bacteria 10214
5 Ga0466712_314323 3300042614 Bacteria 2871
6 Ga0466718_040051 3300042617 Bacteria 10363
7 AustNasuHG_c1000331 3300000089 Bacteria 16402
8 AustNasuHG_c1004728 3300000089 Unclassified 4877
9 JGI24698J34947_10054832 3300002449 Bacteria 1988
10 Ga0072941_1003349 3300005201 Bacteria 40356
11 Ga0466720_112838 3300042607 Bacteria 7460
12 Ga0466720_122228 3300042607 Bacteria 4927
13 Ga0466712_028887 3300042614 Bacteria 7803
14 Ga0466712_314881 3300042614 Bacteria 28566
15 FAAS_10001252 3300001880 Bacteria 2119
16 JGI24698J34947_10035884 3300002449 Unclassified 2584
17 JGI24698J34947_10051503 3300002449 Bacteria 2070
18 JGI24698J34947_10073117 3300002449 Unclassified 1638
19 Ga0072941_1008228 3300005201 Bacteria 8459
20 Ga0072941_1199536 3300005201 Bacteria 7955
21 Ga0466720_028609 3300042607 Bacteria 3081
22 Ga0466720_108394 3300042607 Bacteria 4634
23 Ga0466720_169032 3300042607 Bacteria 23174
24 Ga0123355_10201843 3300009826 Bacteria 2902
25 Ga0123356_10001228 3300010049 Bacteria 28467
26 Ga0123353_10240217 3300010167 Bacteria 2815
27 Ga0466731_349246 3300042622 Bacteria 4355
28 Ga0466718_078874 3300042617 Bacteria 12737
29 2230954224 2228664003 Bacteria 9895
30 AustNasuHG_c1001074 3300000089 Bacteria 9823
31 AustNasuHG_c1002522 3300000089 Bacteria 6631
32 JGI24698J34947_10023003 3300002449 Bacteria 3336
33 JGI24698J34947_10035964 3300002449 Unclassified 2581
34 JGI24698J34947_10036379 3300002449 Unclassified 2564
35 JGI24695J34938_10024665 3300002450 Bacteria 2885
36 JGI24697J35500_11259319 3300002507 Bacteria 2910
37 Ga0072941_1011845 3300005201 Bacteria 9616
38 Ga0415639_006628 3300038395 Bacteria 26188
39 Ga0415639_079915 3300038395 Bacteria 1095
40 Ga0466694_339879 3300042594 Bacteria 2942
41 Ga0466699_102664 3300042597 Bacteria 3339
42 Ga0466720_052852 3300042607 Bacteria 6648
43 Ga0466720_189904 3300042607 Bacteria 19102
44 Ga0466721_322799 3300042608 Bacteria 1681
45 Ga0123353_10000313 3300010167 Bacteria 59874
46 Ga0466712_013452 3300042614 Bacteria 13605
47 Ga0466712_025029 3300042614 Bacteria 2180
48 Ga0466712_173852 3300042614 Bacteria 8402
49 Ga0466718_082593 3300042617 Bacteria 1999
50 AustNasuHG_c1008332 3300000089 Bacteria 3673
51 AustNasuHG_c1012435 3300000089 Bacteria 2938
52 Ga0072941_1029356 3300005201 Bacteria 6120
53 Ga0072941_1037577 3300005201 Archaea 5917
54 Ga0466694_057265 3300042594 Bacteria 3500
55 Ga0466720_209520 3300042607 Bacteria 1334
56 Ga0123356_10025917 3300010049 Bacteria 5512
57 Ga0123356_10073354 3300010049 Bacteria 3218
58 AustNasuHG_c1004018 3300000089 Unclassified 5295
59 AustNasuHG_c1011241 3300000089 Bacteria 3104
60 AustNasuHG_c1016595 3300000089 Bacteria 2461
61 JGI24698J34947_10007781 3300002449 Bacteria 5885
62 JGI24698J34947_10040392 3300002449 Bacteria 2409
63 JGI24695J34938_10002481 3300002450 Bacteria 14067
64 JGI24695J34938_10012261 3300002450 Bacteria 4556
65 JGI24699J35502_11131103 3300002509 Unclassified 5462
66 Ga0072941_1001172 3300005201 Bacteria 15822
67 Ga0072941_1005337 3300005201 Bacteria 5804
68 Ga0072941_1011377 3300005201 Bacteria 14121
69 Ga0072941_1056655 3300005201 Bacteria 4472
70 Ga0072941_1083347 3300005201 Bacteria 9886
71 Ga0074263_110972 3300005485 Bacteria 1567
72 Ga0415639_020055 3300038395 Bacteria 9845
73 Ga0466720_104482 3300042607 Unclassified 6438
74 Ga0466720_140535 3300042607 Unclassified 4019
75 Ga0123356_10220038 3300010049 Bacteria 1954
76 Ga0466731_323752 3300042622 Bacteria 4107
77 Ga0466712_032244 3300042614 Bacteria 5474
78 Ga0466712_059886 3300042614 Bacteria 32530
79 Ga0466712_098580 3300042614 Unclassified 1875
80 Ga0466712_106979 3300042614 Bacteria 6327
81 Ga0466712_116043 3300042614 Bacteria 12444
82 Ga0466718_066808 3300042617 Bacteria 4265
83 AustNasuHG_c1002239 3300000089 Unclassified 6977
84 JGI24698J34947_10014045 3300002449 Unclassified 4364
85 JGI24698J34947_10035887 3300002449 Bacteria 2584
86 JGI24698J34947_10051989 3300002449 Bacteria 2058
87 JGI24695J34938_10001508 3300002450 Bacteria 19641
88 Ga0072941_1071878 3300005201 Bacteria 3754
89 Ga0415639_000516 3300038395 Bacteria 10144
90 Ga0466720_109261 3300042607 Bacteria 1689
91 Ga0466732_074229 3300042656 Bacteria 2882
92 Ga0466732_182889 3300042656 Bacteria 14007
93 Ga0466731_075001 3300042622 Bacteria 2092
94 Ga0466702_048133 3300042635 Bacteria 2665
95 Ga0466712_154030 3300042614 Bacteria 6813
96 Ga0466718_038020 3300042617 Bacteria 11646
97 Ga0466718_084171 3300042617 Bacteria 16920
98 AustNasuHG_c1009439 3300000089 Bacteria 3426
99 Ga0072941_1018195 3300005201 Bacteria 6063
100 Ga0264413_110358 3300024493 Bacteria 12968
101 Ga0264413_123371 3300024493 Bacteria 3589
102 Ga0466693_235202 3300042592 Bacteria 3690
103 Ga0466694_026831 3300042594 Bacteria 2724
104 Ga0466699_024640 3300042597 Bacteria 2706
105 Ga0123355_10000121 3300009826 Bacteria 89097
106 Ga0123356_10011988 3300010049 Bacteria 8436
107 Ga0466712_025280 3300042614 Unclassified 2015
108 Ga0466712_104102 3300042614 Bacteria 1772
109 Ga0466718_002231 3300042617 Bacteria 1711
110 AustNasuHG_c1019697 3300000089 Bacteria 2210
111 JGI24698J34947_10011616 3300002449 Bacteria 4834
112 JGI24698J34947_10011931 3300002449 Bacteria 4771
113 JGI24698J34947_10034343 3300002449 Bacteria 2655
114 JGI24698J34947_10040342 3300002449 Bacteria 2411
115 JGI24698J34947_10052027 3300002449 Bacteria 2057
116 JGI24695J34938_10000053 3300002450 Bacteria 90544
117 Ga0072941_1000820 3300005201 Bacteria 119098
118 Ga0072941_1029387 3300005201 Bacteria 6548
119 Ga0264413_106093 3300024493 Bacteria 13977
120 Ga0466694_013217 3300042594 Bacteria 1282
121 Ga0466695_259092 3300042595 Bacteria 134193
122 Ga0466699_162560 3300042597 Bacteria 3713
123 Ga0466720_116545 3300042607 Bacteria 3191

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00144 Beta-lactamase Beta-lactamase 54 401 0.78

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.