Protein Family IF08608
Metagenome
Isolate
119
Members
39
Samples
118
Scaffolds
264.76
Avg Length
Representative Sequence
- ID
- 3300042622|Ga0466731_226221|Ga0466731_226221_388_1242
- Length
- 284 aa
- Sequence
- MGRWLSTTNHKGDKTVIEQFYNFKHAPFERNIPVEHLYTTPKFDELLSRLDYAARMRKFIVLTGDVGVGKTTAIRKFASMLDRKCFRCIYVADSALTPRVFYWEVLTQLSSDEKPSFYRSEGKRKIMDRFAQLAESSQVISIVIIDEAHLLSPTMLEETRFLLNIGMDSQNPMGLVIVGQSELRQKLSAEVYEPITQRIDFRFALVPFDRGQTQDYIHAHMRYAGAAKEIFSPSAVDAIFDYSGGVARKVNKACSLSLLYAAQKSMHTIDASAINFVVDQELTW
Sample Types
Isolate
0.8%
Metagenome
99.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
76.3%
Kalotermitidae
18.4%
Hodotermitidae
2.6%
Unclassified
2.6%
Taxonomy
Archaea
2
Bacteria
103
Eukaryota
0
Viruses
1
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 2 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 3 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 4 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 5 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 6 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 7 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 8 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 9 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 10 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 11 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 12 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 13 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 14 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 15 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 16 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 17 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 18 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 19 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 20 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 21 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 22 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 23 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 24 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 25 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 26 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 27 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 28 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 29 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 30 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 31 | 2820501819 | Unclassified Firmicutes Lab288P1bin51 | Isolate | Unclassified |
| 32 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 33 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 34 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 35 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 36 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 37 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 38 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 39 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123357_10247907 | 3300009784 | Bacteria | 1913 |
| 2 | Ga0123356_10513857 | 3300010049 | Bacteria | 1355 |
| 3 | Ga0123353_10096604 | 3300010167 | Bacteria | 4762 |
| 4 | Ga0123353_10150717 | 3300010167 | Bacteria | 3713 |
| 5 | Ga0466700_373655 | 3300042600 | Bacteria | 9930 |
| 6 | Ga0466717_055301 | 3300042604 | Bacteria | 4584 |
| 7 | Ga0466720_234976 | 3300042607 | Bacteria | 4099 |
| 8 | Ga0415639_246187 | 3300038395 | Bacteria | 2543 |
| 9 | Ga0466656_268393 | 3300042550 | Bacteria | 2258 |
| 10 | Ga0466690_201998 | 3300042590 | Unclassified | 10185 |
| 11 | Ga0466693_113177 | 3300042592 | Bacteria | 6453 |
| 12 | Ga0466693_243053 | 3300042592 | Bacteria | 5039 |
| 13 | Ga0466693_319469 | 3300042592 | Bacteria | 3102 |
| 14 | Ga0466734_118083 | 3300042623 | Bacteria | 3643 |
| 15 | Ga0466704_435507 | 3300042643 | Archaea | 4417 |
| 16 | Ga0123356_10049647 | 3300010049 | Bacteria | 3906 |
| 17 | Ga0123353_10406928 | 3300010167 | Bacteria | 2022 |
| 18 | Ga0123353_10449092 | 3300010167 | Bacteria | 1899 |
| 19 | Ga0466700_426666 | 3300042600 | Bacteria | 1318 |
| 20 | Ga0466717_136482 | 3300042604 | Bacteria | 2108 |
| 21 | Ga0466721_109121 | 3300042608 | Bacteria | 2713 |
| 22 | JGI24695J34938_10033234 | 3300002450 | Unclassified | 2375 |
| 23 | JGI24695J34938_10037770 | 3300002450 | Bacteria | 2192 |
| 24 | JGI24702J35022_10016603 | 3300002462 | Bacteria | 4033 |
| 25 | JGI24702J35022_10034674 | 3300002462 | Bacteria | 2699 |
| 26 | Ga0072941_1254478 | 3300005201 | Bacteria | 2818 |
| 27 | Ga0466657_119408 | 3300042582 | Bacteria | 2038 |
| 28 | Ga0466657_379712 | 3300042582 | Bacteria | 1033 |
| 29 | Ga0466694_217577 | 3300042594 | Bacteria | 4192 |
| 30 | Ga0466694_351832 | 3300042594 | Unclassified | 7959 |
| 31 | Ga0466699_048710 | 3300042597 | Bacteria | 1350 |
| 32 | Ga0466731_130923 | 3300042622 | Bacteria | 2660 |
| 33 | Ga0466734_016902 | 3300042623 | Bacteria | 1320 |
| 34 | Ga0466702_302452 | 3300042635 | Bacteria | 3388 |
| 35 | Ga0123357_10076177 | 3300009784 | Bacteria | 4431 |
| 36 | Ga0123357_10141295 | 3300009784 | Bacteria | 2958 |
| 37 | Ga0123356_10415875 | 3300010049 | Bacteria | 1485 |
| 38 | Ga0123353_10167061 | 3300010167 | Bacteria | 3497 |
| 39 | Ga0123353_10283792 | 3300010167 | Unclassified | 2540 |
| 40 | Ga0123354_10219692 | 3300010882 | Bacteria | 2023 |
| 41 | Ga0466721_357859 | 3300042608 | Bacteria | 4224 |
| 42 | Ga0466698_031569 | 3300042610 | Bacteria | 4121 |
| 43 | JGI24702J35022_10065222 | 3300002462 | Bacteria | 1953 |
| 44 | Ga0072941_1219970 | 3300005201 | Bacteria | 4582 |
| 45 | Ga0415639_146858 | 3300038395 | Bacteria | 4132 |
| 46 | Ga0415639_165830 | 3300038395 | Bacteria | 1893 |
| 47 | Ga0466699_083811 | 3300042597 | Bacteria | 2926 |
| 48 | Ga0466705_307310 | 3300042612 | Bacteria | 3271 |
| 49 | Ga0466731_237391 | 3300042622 | Bacteria | 4690 |
| 50 | Ga0466710_052281 | 3300042613 | Bacteria | 2092 |
| 51 | Ga0466723_060416 | 3300042618 | Bacteria | 7227 |
| 52 | Ga0123356_10589776 | 3300010049 | Bacteria | 1275 |
| 53 | Ga0123353_10215819 | 3300010167 | Bacteria | 3005 |
| 54 | Ga0466701_047256 | 3300042598 | Bacteria | 3044 |
| 55 | JGI24698J34947_10028925 | 3300002449 | Bacteria | 2932 |
| 56 | JGI24705J35276_12214892 | 3300002504 | Unclassified | 1979 |
| 57 | JGI24705J35276_12221309 | 3300002504 | Bacteria | 2331 |
| 58 | Ga0415639_076740 | 3300038395 | Bacteria | 1377 |
| 59 | Ga0466693_065601 | 3300042592 | Unclassified | 2392 |
| 60 | Ga0466731_105732 | 3300042622 | Bacteria | 1758 |
| 61 | Ga0466731_226221 | 3300042622 | Bacteria | 1312 |
| 62 | Ga0466734_016363 | 3300042623 | Bacteria | 1274 |
| 63 | Ga0466724_04714 | 3300042649 | Bacteria | 1110 |
| 64 | Ga0466728_016800 | 3300042620 | Archaea | 3695 |
| 65 | Ga0123356_10158856 | 3300010049 | Bacteria | 2255 |
| 66 | Ga0123356_10513423 | 3300010049 | Bacteria | 1356 |
| 67 | Ga0466700_169065 | 3300042600 | Bacteria | 4125 |
| 68 | Ga0466700_486243 | 3300042600 | Bacteria | 2779 |
| 69 | JGI24696J40584_12946135 | 3300002834 | Unclassified | 1884 |
| 70 | Ga0072941_1103361 | 3300005201 | Bacteria | 5729 |
| 71 | Ga0466656_234970 | 3300042550 | Bacteria | 1450 |
| 72 | Ga0466693_240073 | 3300042592 | Unclassified | 1543 |
| 73 | Ga0466697_087537 | 3300042611 | Bacteria | 4747 |
| 74 | Ga0466731_045005 | 3300042622 | Bacteria | 8149 |
| 75 | Ga0466731_378374 | 3300042622 | Bacteria | 1790 |
| 76 | Ga0466702_127097 | 3300042635 | Bacteria | 2660 |
| 77 | Ga0123356_10040944 | 3300010049 | Bacteria | 4317 |
| 78 | Ga0123356_10049130 | 3300010049 | Bacteria | 3927 |
| 79 | Ga0123353_10119941 | 3300010167 | Bacteria | 4229 |
| 80 | Ga0123353_10287777 | 3300010167 | Bacteria | 2518 |
| 81 | Ga0466706_144500 | 3300042599 | Bacteria | 4499 |
| 82 | Ga0466700_289432 | 3300042600 | Bacteria | 5850 |
| 83 | Ga0466721_310554 | 3300042608 | Bacteria | 1635 |
| 84 | JGI24702J35022_10016967 | 3300002462 | Bacteria | 3986 |
| 85 | Ga0466656_154256 | 3300042550 | Unclassified | 1575 |
| 86 | Ga0466693_106831 | 3300042592 | Bacteria | 4210 |
| 87 | Ga0466694_408953 | 3300042594 | Bacteria | 1029 |
| 88 | Ga0466695_333004 | 3300042595 | Bacteria | 3861 |
| 89 | Ga0466696_406176 | 3300042596 | Bacteria | 3073 |
| 90 | Ga0123356_10049419 | 3300010049 | Bacteria | 3915 |
| 91 | Ga0123354_10122437 | 3300010882 | Bacteria | 3348 |
| 92 | Ga0466698_138117 | 3300042610 | Bacteria | 2907 |
| 93 | JGI24698J34947_10044598 | 3300002449 | Bacteria | 2269 |
| 94 | JGI24705J35276_12229599 | 3300002504 | Bacteria | 3421 |
| 95 | Ga0415639_055380 | 3300038395 | Bacteria | 3954 |
| 96 | Ga0415639_089957 | 3300038395 | Bacteria | 3259 |
| 97 | Ga0415639_110160 | 3300038395 | Bacteria | 3375 |
| 98 | Ga0466693_004428 | 3300042592 | Bacteria | 1309 |
| 99 | Ga0466695_298045 | 3300042595 | Bacteria | 4482 |
| 100 | Ga0466696_329558 | 3300042596 | Bacteria | 3545 |
| 101 | Ga0466697_065433 | 3300042611 | Bacteria | 3648 |
| 102 | Ga0466731_121950 | 3300042622 | Unclassified | 4406 |
| 103 | Ga0466715_391371 | 3300042616 | Bacteria | 7403 |
| 104 | Ga0123356_10166769 | 3300010049 | Unclassified | 2207 |
| 105 | Ga0123353_10342673 | 3300010167 | Unclassified | 2257 |
| 106 | Ga0123353_10353272 | 3300010167 | Unclassified | 2213 |
| 107 | Ga0123354_10290736 | 3300010882 | Bacteria | 1567 |
| 108 | Ga0466700_378490 | 3300042600 | Bacteria | 3769 |
| 109 | Ga0466698_171136 | 3300042610 | Bacteria | 3455 |
| 110 | Ga0072940_1010115 | 3300005200 | Bacteria | 4377 |
| 111 | Ga0072941_1370038 | 3300005201 | Bacteria | 2230 |
| 112 | Ga0415639_015167 | 3300038395 | Bacteria | 3977 |
| 113 | Ga0466693_011381 | 3300042592 | Viruses | 4504 |
| 114 | Ga0466693_102025 | 3300042592 | Bacteria | 5857 |
| 115 | Ga0466693_272600 | 3300042592 | Bacteria | 2513 |
| 116 | Ga0466731_009762 | 3300042622 | Bacteria | 4284 |
| 117 | Ga0466731_310437 | 3300042622 | Bacteria | 1518 |
| 118 | Ga0466702_086399 | 3300042635 | Bacteria | 2071 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042600 | Ga0466700_426666 | Ga0466700_426666_20_727 | 235 |
| 2 | 3300042608 | Ga0466721_310554 | Ga0466721_310554_10_720 | 236 |
| 3 | 3300042590 | Ga0466690_201998 | Ga0466690_201998_5892_6701 | 242 |
| 4 | 3300042600 | Ga0466700_169065 | Ga0466700_169065_1869_2678 | 244 |
| 5 | 3300002449 | JGI24698J34947_10044598 | JGI24698J34947_100445982 | 245 |
| 6 | 3300042592 | Ga0466693_011381 | Ga0466693_011381_2559_3368 | 246 |
| 7 | 3300042643 | Ga0466704_435507 | Ga0466704_435507_2476_3285 | 247 |
| 8 | 3300002504 | JGI24705J35276_12229599 | JGI24705J35276_122295993 | 248 |
| 9 | 3300042594 | Ga0466694_217577 | Ga0466694_217577_3288_4097 | 248 |
| 10 | 3300005200 | Ga0072940_1010115 | Ga0072940_10101154 | 249 |
| 11 | 3300042604 | Ga0466717_055301 | Ga0466717_055301_2425_3234 | 249 |
| 12 | 3300002834 | JGI24696J40584_12946135 | JGI24696J40584_129461353 | 250 |
| 13 | 3300010167 | Ga0123353_10283792 | Ga0123353_102837922 | 250 |
| 14 | 3300042592 | Ga0466693_106831 | Ga0466693_106831_893_1702 | 250 |
| 15 | 3300042592 | Ga0466693_240073 | Ga0466693_240073_541_1350 | 250 |
| 16 | 3300042594 | Ga0466694_351832 | Ga0466694_351832_848_1657 | 250 |
| 17 | 3300042620 | Ga0466728_016800 | Ga0466728_016800_687_1496 | 250 |
| 18 | 3300042595 | Ga0466695_298045 | Ga0466695_298045_2306_3115 | 251 |
| 19 | 3300042607 | Ga0466720_234976 | Ga0466720_234976_2416_3222 | 251 |
| 20 | 3300002504 | JGI24705J35276_12221309 | JGI24705J35276_122213092 | 253 |
| 21 | 3300010049 | Ga0123356_10513423 | Ga0123356_105134232 | 253 |
| 22 | 3300010167 | Ga0123353_10215819 | Ga0123353_102158193 | 253 |
| 23 | 3300042597 | Ga0466699_083811 | Ga0466699_083811_1525_2334 | 253 |
| 24 | 3300042622 | Ga0466731_121950 | Ga0466731_121950_2179_2988 | 253 |
| 25 | 3300010049 | Ga0123356_10589776 | Ga0123356_105897762 | 257 |
| 26 | 3300042598 | Ga0466701_047256 | Ga0466701_047256_1450_2259 | 257 |
| 27 | 3300042592 | Ga0466693_319469 | Ga0466693_319469_780_1589 | 258 |
| 28 | 3300005201 | Ga0072941_1370038 | Ga0072941_13700384 | 259 |
| 29 | 3300042600 | Ga0466700_373655 | Ga0466700_373655_2549_3328 | 259 |
| 30 | 3300042623 | Ga0466734_016902 | Ga0466734_016902_393_1172 | 259 |
| 31 | 3300010049 | Ga0123356_10158856 | Ga0123356_101588562 | 268 |
| 32 | 3300010167 | Ga0123353_10353272 | Ga0123353_103532724 | 268 |
| 33 | 3300010882 | Ga0123354_10290736 | Ga0123354_102907363 | 268 |
| 34 | 3300042611 | Ga0466697_065433 | Ga0466697_065433_1615_2421 | 268 |
| 35 | 3300042613 | Ga0466710_052281 | Ga0466710_052281_806_1612 | 268 |
| 36 | 3300002449 | JGI24698J34947_10028925 | JGI24698J34947_100289254 | 269 |
| 37 | 3300002462 | JGI24702J35022_10034674 | JGI24702J35022_100346742 | 269 |
| 38 | 3300010882 | Ga0123354_10122437 | Ga0123354_101224372 | 269 |
| 39 | 3300038395 | Ga0415639_015167 | Ga0415639_015167_831_1640 | 269 |
| 40 | 3300038395 | Ga0415639_055380 | Ga0415639_055380_2060_2869 | 269 |
| 41 | 3300038395 | Ga0415639_076740 | Ga0415639_076740_147_956 | 269 |
| 42 | 3300038395 | Ga0415639_089957 | Ga0415639_089957_2277_3086 | 269 |
| 43 | 3300038395 | Ga0415639_110160 | Ga0415639_110160_2227_3036 | 269 |
| 44 | 3300038395 | Ga0415639_146858 | Ga0415639_146858_2708_3517 | 269 |
| 45 | 3300038395 | Ga0415639_165830 | Ga0415639_165830_339_1148 | 269 |
| 46 | 3300038395 | Ga0415639_246187 | Ga0415639_246187_391_1200 | 269 |
| 47 | 3300042550 | Ga0466656_154256 | Ga0466656_154256_310_1119 | 269 |
| 48 | 3300042550 | Ga0466656_268393 | Ga0466656_268393_1119_1928 | 269 |
| 49 | 3300042582 | Ga0466657_119408 | Ga0466657_119408_904_1713 | 269 |
| 50 | 3300042582 | Ga0466657_379712 | Ga0466657_379712_127_936 | 269 |
| 51 | 3300042592 | Ga0466693_004428 | Ga0466693_004428_42_851 | 269 |
| 52 | 3300042592 | Ga0466693_065601 | Ga0466693_065601_850_1659 | 269 |
| 53 | 3300042592 | Ga0466693_102025 | Ga0466693_102025_3075_3884 | 269 |
| 54 | 3300042592 | Ga0466693_113177 | Ga0466693_113177_3176_3985 | 269 |
| 55 | 3300042592 | Ga0466693_243053 | Ga0466693_243053_1130_1939 | 269 |
| 56 | 3300042592 | Ga0466693_272600 | Ga0466693_272600_865_1674 | 269 |
| 57 | 3300042594 | Ga0466694_408953 | Ga0466694_408953_204_1013 | 269 |
| 58 | 3300042595 | Ga0466695_333004 | Ga0466695_333004_2481_3290 | 269 |
| 59 | 3300042596 | Ga0466696_329558 | Ga0466696_329558_2022_2831 | 269 |
| 60 | 3300042596 | Ga0466696_406176 | Ga0466696_406176_882_1691 | 269 |
| 61 | 3300042597 | Ga0466699_048710 | Ga0466699_048710_435_1244 | 269 |
| 62 | 3300042599 | Ga0466706_144500 | Ga0466706_144500_1013_1822 | 269 |
| 63 | 3300042600 | Ga0466700_289432 | Ga0466700_289432_4000_4809 | 269 |
| 64 | 3300042600 | Ga0466700_486243 | Ga0466700_486243_1118_1927 | 269 |
| 65 | 3300042604 | Ga0466717_136482 | Ga0466717_136482_509_1318 | 269 |
| 66 | 3300042608 | Ga0466721_109121 | Ga0466721_109121_714_1523 | 269 |
| 67 | 3300042608 | Ga0466721_357859 | Ga0466721_357859_2327_3136 | 269 |
| 68 | 3300042610 | Ga0466698_031569 | Ga0466698_031569_2606_3415 | 269 |
| 69 | 3300042610 | Ga0466698_138117 | Ga0466698_138117_1404_2213 | 269 |
| 70 | 3300042610 | Ga0466698_171136 | Ga0466698_171136_926_1735 | 269 |
| 71 | 3300042612 | Ga0466705_307310 | Ga0466705_307310_622_1431 | 269 |
| 72 | 3300042616 | Ga0466715_391371 | Ga0466715_391371_845_1654 | 269 |
| 73 | 3300042618 | Ga0466723_060416 | Ga0466723_060416_2502_3311 | 269 |
| 74 | 3300042622 | Ga0466731_009762 | Ga0466731_009762_2397_3206 | 269 |
| 75 | 3300042622 | Ga0466731_045005 | Ga0466731_045005_3978_4787 | 269 |
| 76 | 3300042622 | Ga0466731_105732 | Ga0466731_105732_73_882 | 269 |
| 77 | 3300042622 | Ga0466731_130923 | Ga0466731_130923_1069_1878 | 269 |
| 78 | 3300042622 | Ga0466731_237391 | Ga0466731_237391_1115_1924 | 269 |
| 79 | 3300042622 | Ga0466731_310437 | Ga0466731_310437_344_1153 | 269 |
| 80 | 3300042622 | Ga0466731_378374 | Ga0466731_378374_453_1262 | 269 |
| 81 | 3300042623 | Ga0466734_118083 | Ga0466734_118083_402_1211 | 269 |
| 82 | 3300042635 | Ga0466702_086399 | Ga0466702_086399_804_1613 | 269 |
| 83 | 3300042649 | Ga0466724_04714 | Ga0466724_04714_24_833 | 269 |
| 84 | iso_pr_bacteria | 2820501819 | 2820504329 | 269 |
| 85 | 3300002450 | JGI24695J34938_10033234 | JGI24695J34938_100332343 | 270 |
| 86 | 3300002450 | JGI24695J34938_10037770 | JGI24695J34938_100377704 | 270 |
| 87 | 3300002504 | JGI24705J35276_12214892 | JGI24705J35276_122148923 | 270 |
| 88 | 3300005201 | Ga0072941_1103361 | Ga0072941_11033614 | 270 |
| 89 | 3300005201 | Ga0072941_1254478 | Ga0072941_12544782 | 270 |
| 90 | 3300009784 | Ga0123357_10076177 | Ga0123357_100761772 | 270 |
| 91 | 3300009784 | Ga0123357_10141295 | Ga0123357_101412953 | 270 |
| 92 | 3300009784 | Ga0123357_10247907 | Ga0123357_102479071 | 270 |
| 93 | 3300010049 | Ga0123356_10040944 | Ga0123356_100409443 | 270 |
| 94 | 3300010049 | Ga0123356_10049130 | Ga0123356_100491305 | 270 |
| 95 | 3300010049 | Ga0123356_10049419 | Ga0123356_100494193 | 270 |
| 96 | 3300010049 | Ga0123356_10049647 | Ga0123356_100496473 | 270 |
| 97 | 3300010049 | Ga0123356_10166769 | Ga0123356_101667692 | 270 |
| 98 | 3300010049 | Ga0123356_10415875 | Ga0123356_104158752 | 270 |
| 99 | 3300010049 | Ga0123356_10513857 | Ga0123356_105138572 | 270 |
| 100 | 3300010167 | Ga0123353_10096604 | Ga0123353_100966043 | 270 |
| 101 | 3300010167 | Ga0123353_10119941 | Ga0123353_101199414 | 270 |
| 102 | 3300010167 | Ga0123353_10150717 | Ga0123353_101507173 | 270 |
| 103 | 3300010167 | Ga0123353_10167061 | Ga0123353_101670612 | 270 |
| 104 | 3300010167 | Ga0123353_10287777 | Ga0123353_102877772 | 270 |
| 105 | 3300010167 | Ga0123353_10342673 | Ga0123353_103426734 | 270 |
| 106 | 3300010167 | Ga0123353_10406928 | Ga0123353_104069282 | 270 |
| 107 | 3300010167 | Ga0123353_10449092 | Ga0123353_104490922 | 270 |
| 108 | 3300010882 | Ga0123354_10219692 | Ga0123354_102196922 | 270 |
| 109 | 3300042611 | Ga0466697_087537 | Ga0466697_087537_2788_3600 | 270 |
| 110 | 3300042635 | Ga0466702_127097 | Ga0466702_127097_478_1290 | 270 |
| 111 | 3300042635 | Ga0466702_302452 | Ga0466702_302452_246_1058 | 270 |
| 112 | 3300002462 | JGI24702J35022_10065222 | JGI24702J35022_100652222 | 271 |
| 113 | 3300042550 | Ga0466656_234970 | Ga0466656_234970_57_872 | 271 |
| 114 | 3300002462 | JGI24702J35022_10016603 | JGI24702J35022_100166034 | 272 |
| 115 | 3300002462 | JGI24702J35022_10016967 | JGI24702J35022_100169673 | 272 |
| 116 | 3300005201 | Ga0072941_1219970 | Ga0072941_12199703 | 272 |
| 117 | 3300042600 | Ga0466700_378490 | Ga0466700_378490_528_1346 | 272 |
| 118 | 3300042623 | Ga0466734_016363 | Ga0466734_016363_71_904 | 277 |
| 119 | 3300042622 | Ga0466731_226221 | Ga0466731_226221_388_1242 | 284 |
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF13401 | GO:0016887 | ATP hydrolysis activity | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.87 | 0.89 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.