Protein Family IF08608

Metagenome Isolate
119 Members
39 Samples
118 Scaffolds
264.76 Avg Length

🧬 Representative Sequence

ID
3300042622|Ga0466731_226221|Ga0466731_226221_388_1242
Length
284 aa
Sequence
MGRWLSTTNHKGDKTVIEQFYNFKHAPFERNIPVEHLYTTPKFDELLSRLDYAARMRKFIVLTGDVGVGKTTAIRKFASMLDRKCFRCIYVADSALTPRVFYWEVLTQLSSDEKPSFYRSEGKRKIMDRFAQLAESSQVISIVIIDEAHLLSPTMLEETRFLLNIGMDSQNPMGLVIVGQSELRQKLSAEVYEPITQRIDFRFALVPFDRGQTQDYIHAHMRYAGAAKEIFSPSAVDAIFDYSGGVARKVNKACSLSLLYAAQKSMHTIDASAINFVVDQELTW

📊 Sample Types

Isolate 0.8%
Metagenome 99.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 76.3%
Kalotermitidae 18.4%
Hodotermitidae 2.6%
Unclassified 2.6%

🌳 Taxonomy

Archaea 2
Bacteria 103
Eukaryota 0
Viruses 1
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
2 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
3 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
4 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
5 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
6 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
7 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
8 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
9 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
10 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
11 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
12 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
13 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
14 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
15 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
16 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
17 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
18 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
19 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
20 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
21 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
22 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
23 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
24 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
25 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
26 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
27 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
28 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
29 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
30 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
31 2820501819 Unclassified Firmicutes Lab288P1bin51 Isolate Unclassified
32 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
33 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
34 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
35 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
36 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
37 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
38 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
39 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123357_10247907 3300009784 Bacteria 1913
2 Ga0123356_10513857 3300010049 Bacteria 1355
3 Ga0123353_10096604 3300010167 Bacteria 4762
4 Ga0123353_10150717 3300010167 Bacteria 3713
5 Ga0466700_373655 3300042600 Bacteria 9930
6 Ga0466717_055301 3300042604 Bacteria 4584
7 Ga0466720_234976 3300042607 Bacteria 4099
8 Ga0415639_246187 3300038395 Bacteria 2543
9 Ga0466656_268393 3300042550 Bacteria 2258
10 Ga0466690_201998 3300042590 Unclassified 10185
11 Ga0466693_113177 3300042592 Bacteria 6453
12 Ga0466693_243053 3300042592 Bacteria 5039
13 Ga0466693_319469 3300042592 Bacteria 3102
14 Ga0466734_118083 3300042623 Bacteria 3643
15 Ga0466704_435507 3300042643 Archaea 4417
16 Ga0123356_10049647 3300010049 Bacteria 3906
17 Ga0123353_10406928 3300010167 Bacteria 2022
18 Ga0123353_10449092 3300010167 Bacteria 1899
19 Ga0466700_426666 3300042600 Bacteria 1318
20 Ga0466717_136482 3300042604 Bacteria 2108
21 Ga0466721_109121 3300042608 Bacteria 2713
22 JGI24695J34938_10033234 3300002450 Unclassified 2375
23 JGI24695J34938_10037770 3300002450 Bacteria 2192
24 JGI24702J35022_10016603 3300002462 Bacteria 4033
25 JGI24702J35022_10034674 3300002462 Bacteria 2699
26 Ga0072941_1254478 3300005201 Bacteria 2818
27 Ga0466657_119408 3300042582 Bacteria 2038
28 Ga0466657_379712 3300042582 Bacteria 1033
29 Ga0466694_217577 3300042594 Bacteria 4192
30 Ga0466694_351832 3300042594 Unclassified 7959
31 Ga0466699_048710 3300042597 Bacteria 1350
32 Ga0466731_130923 3300042622 Bacteria 2660
33 Ga0466734_016902 3300042623 Bacteria 1320
34 Ga0466702_302452 3300042635 Bacteria 3388
35 Ga0123357_10076177 3300009784 Bacteria 4431
36 Ga0123357_10141295 3300009784 Bacteria 2958
37 Ga0123356_10415875 3300010049 Bacteria 1485
38 Ga0123353_10167061 3300010167 Bacteria 3497
39 Ga0123353_10283792 3300010167 Unclassified 2540
40 Ga0123354_10219692 3300010882 Bacteria 2023
41 Ga0466721_357859 3300042608 Bacteria 4224
42 Ga0466698_031569 3300042610 Bacteria 4121
43 JGI24702J35022_10065222 3300002462 Bacteria 1953
44 Ga0072941_1219970 3300005201 Bacteria 4582
45 Ga0415639_146858 3300038395 Bacteria 4132
46 Ga0415639_165830 3300038395 Bacteria 1893
47 Ga0466699_083811 3300042597 Bacteria 2926
48 Ga0466705_307310 3300042612 Bacteria 3271
49 Ga0466731_237391 3300042622 Bacteria 4690
50 Ga0466710_052281 3300042613 Bacteria 2092
51 Ga0466723_060416 3300042618 Bacteria 7227
52 Ga0123356_10589776 3300010049 Bacteria 1275
53 Ga0123353_10215819 3300010167 Bacteria 3005
54 Ga0466701_047256 3300042598 Bacteria 3044
55 JGI24698J34947_10028925 3300002449 Bacteria 2932
56 JGI24705J35276_12214892 3300002504 Unclassified 1979
57 JGI24705J35276_12221309 3300002504 Bacteria 2331
58 Ga0415639_076740 3300038395 Bacteria 1377
59 Ga0466693_065601 3300042592 Unclassified 2392
60 Ga0466731_105732 3300042622 Bacteria 1758
61 Ga0466731_226221 3300042622 Bacteria 1312
62 Ga0466734_016363 3300042623 Bacteria 1274
63 Ga0466724_04714 3300042649 Bacteria 1110
64 Ga0466728_016800 3300042620 Archaea 3695
65 Ga0123356_10158856 3300010049 Bacteria 2255
66 Ga0123356_10513423 3300010049 Bacteria 1356
67 Ga0466700_169065 3300042600 Bacteria 4125
68 Ga0466700_486243 3300042600 Bacteria 2779
69 JGI24696J40584_12946135 3300002834 Unclassified 1884
70 Ga0072941_1103361 3300005201 Bacteria 5729
71 Ga0466656_234970 3300042550 Bacteria 1450
72 Ga0466693_240073 3300042592 Unclassified 1543
73 Ga0466697_087537 3300042611 Bacteria 4747
74 Ga0466731_045005 3300042622 Bacteria 8149
75 Ga0466731_378374 3300042622 Bacteria 1790
76 Ga0466702_127097 3300042635 Bacteria 2660
77 Ga0123356_10040944 3300010049 Bacteria 4317
78 Ga0123356_10049130 3300010049 Bacteria 3927
79 Ga0123353_10119941 3300010167 Bacteria 4229
80 Ga0123353_10287777 3300010167 Bacteria 2518
81 Ga0466706_144500 3300042599 Bacteria 4499
82 Ga0466700_289432 3300042600 Bacteria 5850
83 Ga0466721_310554 3300042608 Bacteria 1635
84 JGI24702J35022_10016967 3300002462 Bacteria 3986
85 Ga0466656_154256 3300042550 Unclassified 1575
86 Ga0466693_106831 3300042592 Bacteria 4210
87 Ga0466694_408953 3300042594 Bacteria 1029
88 Ga0466695_333004 3300042595 Bacteria 3861
89 Ga0466696_406176 3300042596 Bacteria 3073
90 Ga0123356_10049419 3300010049 Bacteria 3915
91 Ga0123354_10122437 3300010882 Bacteria 3348
92 Ga0466698_138117 3300042610 Bacteria 2907
93 JGI24698J34947_10044598 3300002449 Bacteria 2269
94 JGI24705J35276_12229599 3300002504 Bacteria 3421
95 Ga0415639_055380 3300038395 Bacteria 3954
96 Ga0415639_089957 3300038395 Bacteria 3259
97 Ga0415639_110160 3300038395 Bacteria 3375
98 Ga0466693_004428 3300042592 Bacteria 1309
99 Ga0466695_298045 3300042595 Bacteria 4482
100 Ga0466696_329558 3300042596 Bacteria 3545
101 Ga0466697_065433 3300042611 Bacteria 3648
102 Ga0466731_121950 3300042622 Unclassified 4406
103 Ga0466715_391371 3300042616 Bacteria 7403
104 Ga0123356_10166769 3300010049 Unclassified 2207
105 Ga0123353_10342673 3300010167 Unclassified 2257
106 Ga0123353_10353272 3300010167 Unclassified 2213
107 Ga0123354_10290736 3300010882 Bacteria 1567
108 Ga0466700_378490 3300042600 Bacteria 3769
109 Ga0466698_171136 3300042610 Bacteria 3455
110 Ga0072940_1010115 3300005200 Bacteria 4377
111 Ga0072941_1370038 3300005201 Bacteria 2230
112 Ga0415639_015167 3300038395 Bacteria 3977
113 Ga0466693_011381 3300042592 Viruses 4504
114 Ga0466693_102025 3300042592 Bacteria 5857
115 Ga0466693_272600 3300042592 Bacteria 2513
116 Ga0466731_009762 3300042622 Bacteria 4284
117 Ga0466731_310437 3300042622 Bacteria 1518
118 Ga0466702_086399 3300042635 Bacteria 2071

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042600 Ga0466700_426666 Ga0466700_426666_20_727 235
2 3300042608 Ga0466721_310554 Ga0466721_310554_10_720 236
3 3300042590 Ga0466690_201998 Ga0466690_201998_5892_6701 242
4 3300042600 Ga0466700_169065 Ga0466700_169065_1869_2678 244
5 3300002449 JGI24698J34947_10044598 JGI24698J34947_100445982 245
6 3300042592 Ga0466693_011381 Ga0466693_011381_2559_3368 246
7 3300042643 Ga0466704_435507 Ga0466704_435507_2476_3285 247
8 3300002504 JGI24705J35276_12229599 JGI24705J35276_122295993 248
9 3300042594 Ga0466694_217577 Ga0466694_217577_3288_4097 248
10 3300005200 Ga0072940_1010115 Ga0072940_10101154 249
11 3300042604 Ga0466717_055301 Ga0466717_055301_2425_3234 249
12 3300002834 JGI24696J40584_12946135 JGI24696J40584_129461353 250
13 3300010167 Ga0123353_10283792 Ga0123353_102837922 250
14 3300042592 Ga0466693_106831 Ga0466693_106831_893_1702 250
15 3300042592 Ga0466693_240073 Ga0466693_240073_541_1350 250
16 3300042594 Ga0466694_351832 Ga0466694_351832_848_1657 250
17 3300042620 Ga0466728_016800 Ga0466728_016800_687_1496 250
18 3300042595 Ga0466695_298045 Ga0466695_298045_2306_3115 251
19 3300042607 Ga0466720_234976 Ga0466720_234976_2416_3222 251
20 3300002504 JGI24705J35276_12221309 JGI24705J35276_122213092 253
21 3300010049 Ga0123356_10513423 Ga0123356_105134232 253
22 3300010167 Ga0123353_10215819 Ga0123353_102158193 253
23 3300042597 Ga0466699_083811 Ga0466699_083811_1525_2334 253
24 3300042622 Ga0466731_121950 Ga0466731_121950_2179_2988 253
25 3300010049 Ga0123356_10589776 Ga0123356_105897762 257
26 3300042598 Ga0466701_047256 Ga0466701_047256_1450_2259 257
27 3300042592 Ga0466693_319469 Ga0466693_319469_780_1589 258
28 3300005201 Ga0072941_1370038 Ga0072941_13700384 259
29 3300042600 Ga0466700_373655 Ga0466700_373655_2549_3328 259
30 3300042623 Ga0466734_016902 Ga0466734_016902_393_1172 259
31 3300010049 Ga0123356_10158856 Ga0123356_101588562 268
32 3300010167 Ga0123353_10353272 Ga0123353_103532724 268
33 3300010882 Ga0123354_10290736 Ga0123354_102907363 268
34 3300042611 Ga0466697_065433 Ga0466697_065433_1615_2421 268
35 3300042613 Ga0466710_052281 Ga0466710_052281_806_1612 268
36 3300002449 JGI24698J34947_10028925 JGI24698J34947_100289254 269
37 3300002462 JGI24702J35022_10034674 JGI24702J35022_100346742 269
38 3300010882 Ga0123354_10122437 Ga0123354_101224372 269
39 3300038395 Ga0415639_015167 Ga0415639_015167_831_1640 269
40 3300038395 Ga0415639_055380 Ga0415639_055380_2060_2869 269
41 3300038395 Ga0415639_076740 Ga0415639_076740_147_956 269
42 3300038395 Ga0415639_089957 Ga0415639_089957_2277_3086 269
43 3300038395 Ga0415639_110160 Ga0415639_110160_2227_3036 269
44 3300038395 Ga0415639_146858 Ga0415639_146858_2708_3517 269
45 3300038395 Ga0415639_165830 Ga0415639_165830_339_1148 269
46 3300038395 Ga0415639_246187 Ga0415639_246187_391_1200 269
47 3300042550 Ga0466656_154256 Ga0466656_154256_310_1119 269
48 3300042550 Ga0466656_268393 Ga0466656_268393_1119_1928 269
49 3300042582 Ga0466657_119408 Ga0466657_119408_904_1713 269
50 3300042582 Ga0466657_379712 Ga0466657_379712_127_936 269
51 3300042592 Ga0466693_004428 Ga0466693_004428_42_851 269
52 3300042592 Ga0466693_065601 Ga0466693_065601_850_1659 269
53 3300042592 Ga0466693_102025 Ga0466693_102025_3075_3884 269
54 3300042592 Ga0466693_113177 Ga0466693_113177_3176_3985 269
55 3300042592 Ga0466693_243053 Ga0466693_243053_1130_1939 269
56 3300042592 Ga0466693_272600 Ga0466693_272600_865_1674 269
57 3300042594 Ga0466694_408953 Ga0466694_408953_204_1013 269
58 3300042595 Ga0466695_333004 Ga0466695_333004_2481_3290 269
59 3300042596 Ga0466696_329558 Ga0466696_329558_2022_2831 269
60 3300042596 Ga0466696_406176 Ga0466696_406176_882_1691 269
61 3300042597 Ga0466699_048710 Ga0466699_048710_435_1244 269
62 3300042599 Ga0466706_144500 Ga0466706_144500_1013_1822 269
63 3300042600 Ga0466700_289432 Ga0466700_289432_4000_4809 269
64 3300042600 Ga0466700_486243 Ga0466700_486243_1118_1927 269
65 3300042604 Ga0466717_136482 Ga0466717_136482_509_1318 269
66 3300042608 Ga0466721_109121 Ga0466721_109121_714_1523 269
67 3300042608 Ga0466721_357859 Ga0466721_357859_2327_3136 269
68 3300042610 Ga0466698_031569 Ga0466698_031569_2606_3415 269
69 3300042610 Ga0466698_138117 Ga0466698_138117_1404_2213 269
70 3300042610 Ga0466698_171136 Ga0466698_171136_926_1735 269
71 3300042612 Ga0466705_307310 Ga0466705_307310_622_1431 269
72 3300042616 Ga0466715_391371 Ga0466715_391371_845_1654 269
73 3300042618 Ga0466723_060416 Ga0466723_060416_2502_3311 269
74 3300042622 Ga0466731_009762 Ga0466731_009762_2397_3206 269
75 3300042622 Ga0466731_045005 Ga0466731_045005_3978_4787 269
76 3300042622 Ga0466731_105732 Ga0466731_105732_73_882 269
77 3300042622 Ga0466731_130923 Ga0466731_130923_1069_1878 269
78 3300042622 Ga0466731_237391 Ga0466731_237391_1115_1924 269
79 3300042622 Ga0466731_310437 Ga0466731_310437_344_1153 269
80 3300042622 Ga0466731_378374 Ga0466731_378374_453_1262 269
81 3300042623 Ga0466734_118083 Ga0466734_118083_402_1211 269
82 3300042635 Ga0466702_086399 Ga0466702_086399_804_1613 269
83 3300042649 Ga0466724_04714 Ga0466724_04714_24_833 269
84 iso_pr_bacteria 2820501819 2820504329 269
85 3300002450 JGI24695J34938_10033234 JGI24695J34938_100332343 270
86 3300002450 JGI24695J34938_10037770 JGI24695J34938_100377704 270
87 3300002504 JGI24705J35276_12214892 JGI24705J35276_122148923 270
88 3300005201 Ga0072941_1103361 Ga0072941_11033614 270
89 3300005201 Ga0072941_1254478 Ga0072941_12544782 270
90 3300009784 Ga0123357_10076177 Ga0123357_100761772 270
91 3300009784 Ga0123357_10141295 Ga0123357_101412953 270
92 3300009784 Ga0123357_10247907 Ga0123357_102479071 270
93 3300010049 Ga0123356_10040944 Ga0123356_100409443 270
94 3300010049 Ga0123356_10049130 Ga0123356_100491305 270
95 3300010049 Ga0123356_10049419 Ga0123356_100494193 270
96 3300010049 Ga0123356_10049647 Ga0123356_100496473 270
97 3300010049 Ga0123356_10166769 Ga0123356_101667692 270
98 3300010049 Ga0123356_10415875 Ga0123356_104158752 270
99 3300010049 Ga0123356_10513857 Ga0123356_105138572 270
100 3300010167 Ga0123353_10096604 Ga0123353_100966043 270
101 3300010167 Ga0123353_10119941 Ga0123353_101199414 270
102 3300010167 Ga0123353_10150717 Ga0123353_101507173 270
103 3300010167 Ga0123353_10167061 Ga0123353_101670612 270
104 3300010167 Ga0123353_10287777 Ga0123353_102877772 270
105 3300010167 Ga0123353_10342673 Ga0123353_103426734 270
106 3300010167 Ga0123353_10406928 Ga0123353_104069282 270
107 3300010167 Ga0123353_10449092 Ga0123353_104490922 270
108 3300010882 Ga0123354_10219692 Ga0123354_102196922 270
109 3300042611 Ga0466697_087537 Ga0466697_087537_2788_3600 270
110 3300042635 Ga0466702_127097 Ga0466702_127097_478_1290 270
111 3300042635 Ga0466702_302452 Ga0466702_302452_246_1058 270
112 3300002462 JGI24702J35022_10065222 JGI24702J35022_100652222 271
113 3300042550 Ga0466656_234970 Ga0466656_234970_57_872 271
114 3300002462 JGI24702J35022_10016603 JGI24702J35022_100166034 272
115 3300002462 JGI24702J35022_10016967 JGI24702J35022_100169673 272
116 3300005201 Ga0072941_1219970 Ga0072941_12199703 272
117 3300042600 Ga0466700_378490 Ga0466700_378490_528_1346 272
118 3300042623 Ga0466734_016363 Ga0466734_016363_71_904 277
119 3300042622 Ga0466731_226221 Ga0466731_226221_388_1242 284

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13401 AAA_22 AAA domain 57 187 0.92
PF05621 TniB Bacterial TniB protein 43 182 0.73
PF00004 AAA ATPase family associated with various cellular activities (AAA) 60 189 0.73
PF13191 AAA_16 AAA ATPase domain 43 165 0.67

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF13401 GO:0016887 ATP hydrolysis activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.87 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.