Protein Family IF08603
Metagenome
Isolate
203
Members
48
Samples
201
Scaffolds
328.94
Avg Length
Representative Sequence
- ID
- 3300042622|Ga0466731_198671|Ga0466731_198671_1922_3076
- Length
- 384 aa
- Sequence
- MGFKRTWSWVSAEDLGLDIVGIIKKPSSLVNDKSSWYFRVMPVKTAPGYLASFLDRLQQLTESYLSYRKRKILVRKEKQKKKNVLRDWLEAFLWAAGMVLLINQYLFQAYQIPSGSMIDTLLIGDRIFVNKTVYGPELLPGFGKLPSPVKPKRNDVIIFENPSYISRGTAFDIVQRIIYMLTLTMVDINRDEHGQPRAQFLIKRAAGMGGDRFIQEQGYMRFRPAGESRWIDENEFREQRAMAHNLIRLMDESAYPALEAAGRAAGYRDIGLPVPASLQAQASAASRIEFPDYIAHEKARLETLRGAFPHESRYSVLLARHNQGYYVPETRIMPLGDSRDNSRDGRYFGPVAYSKILGKGAIVYWPGEFRTKRFGAFQRFGAIR
Sample Types
Isolate
1.0%
Metagenome
99.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.3%
Kalotermitidae
30.4%
Unclassified
8.7%
Rhinotermitidae
8.7%
Termopsidae
6.5%
Blaberidae
2.2%
Hodotermitidae
2.2%
Taxonomy
Archaea
0
Bacteria
193
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 2 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 3 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 4 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 5 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 6 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 7 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 8 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 9 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 10 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 11 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 12 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 13 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 14 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 15 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 16 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 17 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 18 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 19 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 20 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 21 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 22 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 23 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 24 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 25 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 26 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 27 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 28 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 29 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 30 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 31 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 32 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 33 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 34 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 35 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 36 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 37 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 38 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 39 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 40 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 41 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 42 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 43 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 44 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 45 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 46 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 47 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 48 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466731_198671 | 3300042622 | Bacteria | 4042 |
| 2 | Ga0466735_027835 | 3300042624 | Bacteria | 3995 |
| 3 | Ga0466703_043333 | 3300042636 | Bacteria | 3696 |
| 4 | Ga0466704_049686 | 3300042643 | Bacteria | 9727 |
| 5 | Ga0466704_234812 | 3300042643 | Bacteria | 7928 |
| 6 | Ga0466708_010700 | 3300042652 | Bacteria | 13876 |
| 7 | Ga0466708_219643 | 3300042652 | Bacteria | 5430 |
| 8 | Ga0123354_10079986 | 3300010882 | Bacteria | 4631 |
| 9 | Ga0466692_096352 | 3300042591 | Bacteria | 1412 |
| 10 | Ga0466691_044438 | 3300042593 | Bacteria | 3321 |
| 11 | Ga0466720_160418 | 3300042607 | Bacteria | 7190 |
| 12 | Ga0466722_046250 | 3300042609 | Bacteria | 3748 |
| 13 | Ga0466705_525528 | 3300042612 | Bacteria | 8756 |
| 14 | Ga0466712_055581 | 3300042614 | Bacteria | 2001 |
| 15 | Ga0466712_078961 | 3300042614 | Bacteria | 1827 |
| 16 | Ga0466715_316211 | 3300042616 | Bacteria | 16355 |
| 17 | Ga0466723_130527 | 3300042618 | Bacteria | 8168 |
| 18 | Ga0466726_340371 | 3300042619 | Bacteria | 1256 |
| 19 | Ga0466728_004738 | 3300042620 | Bacteria | 32651 |
| 20 | Ga0466728_160193 | 3300042620 | Bacteria | 15278 |
| 21 | Ga0466728_408412 | 3300042620 | Bacteria | 2849 |
| 22 | JGI24698J34947_10034046 | 3300002449 | Bacteria | 2669 |
| 23 | Ga0466703_371941 | 3300042636 | Bacteria | 5101 |
| 24 | Ga0466704_114169 | 3300042643 | Bacteria | 1604 |
| 25 | Ga0123357_10104839 | 3300009784 | Bacteria | 3629 |
| 26 | Ga0415639_100080 | 3300038395 | Bacteria | 4310 |
| 27 | Ga0466696_051225 | 3300042596 | Bacteria | 5250 |
| 28 | Ga0466700_113532 | 3300042600 | Bacteria | 1127 |
| 29 | Ga0466716_074062 | 3300042605 | Bacteria | 4510 |
| 30 | Ga0466716_297581 | 3300042605 | Bacteria | 3560 |
| 31 | Ga0466719_347973 | 3300042606 | Bacteria | 4193 |
| 32 | Ga0466719_507080 | 3300042606 | Bacteria | 12712 |
| 33 | Ga0466722_036364 | 3300042609 | Bacteria | 10739 |
| 34 | Ga0466722_108259 | 3300042609 | Bacteria | 11379 |
| 35 | Ga0466705_506932 | 3300042612 | Bacteria | 4416 |
| 36 | Ga0466712_157083 | 3300042614 | Bacteria | 6046 |
| 37 | Ga0466711_146423 | 3300042615 | Bacteria | 13229 |
| 38 | Ga0466715_085266 | 3300042616 | Bacteria | 14198 |
| 39 | Ga0466718_044412 | 3300042617 | Bacteria | 3759 |
| 40 | Ga0466718_154204 | 3300042617 | Bacteria | 1957 |
| 41 | Ga0466726_120361 | 3300042619 | Bacteria | 14893 |
| 42 | Ga0466726_460321 | 3300042619 | Bacteria | 2228 |
| 43 | Ga0466726_475920 | 3300042619 | Bacteria | 3943 |
| 44 | AustNasuHG_c1000552 | 3300000089 | Bacteria | 13157 |
| 45 | JGI24702J35022_10004450 | 3300002462 | Bacteria | 8320 |
| 46 | Ga0466705_062691 | 3300042612 | Bacteria | 11161 |
| 47 | Ga0466732_412089 | 3300042656 | Unclassified | 3139 |
| 48 | Ga0466704_094942 | 3300042643 | Bacteria | 57318 |
| 49 | Ga0466704_239099 | 3300042643 | Bacteria | 4991 |
| 50 | Ga0466727_177987 | 3300042655 | Bacteria | 3700 |
| 51 | Ga0466727_332810 | 3300042655 | Bacteria | 1981 |
| 52 | Ga0123353_10083984 | 3300010167 | Bacteria | 5126 |
| 53 | Ga0264413_121215 | 3300024493 | Bacteria | 7067 |
| 54 | Ga0466692_171013 | 3300042591 | Bacteria | 10749 |
| 55 | Ga0466696_297210 | 3300042596 | Bacteria | 7106 |
| 56 | Ga0466712_023729 | 3300042614 | Unclassified | 10246 |
| 57 | Ga0466712_040335 | 3300042614 | Bacteria | 8452 |
| 58 | Ga0466715_619875 | 3300042616 | Bacteria | 4535 |
| 59 | Ga0466723_143114 | 3300042618 | Bacteria | 2571 |
| 60 | Ga0466726_427243 | 3300042619 | Bacteria | 17847 |
| 61 | Ga0466705_219458 | 3300042612 | Bacteria | 14353 |
| 62 | Ga0466735_028092 | 3300042624 | Bacteria | 11120 |
| 63 | Ga0466735_117208 | 3300042624 | Bacteria | 5163 |
| 64 | Ga0466703_330768 | 3300042636 | Bacteria | 4830 |
| 65 | Ga0466704_159058 | 3300042643 | Bacteria | 14165 |
| 66 | Ga0466704_505875 | 3300042643 | Bacteria | 7018 |
| 67 | Ga0466704_596100 | 3300042643 | Bacteria | 4510 |
| 68 | Ga0466704_606207 | 3300042643 | Unclassified | 4801 |
| 69 | Ga0123357_10074959 | 3300009784 | Bacteria | 4473 |
| 70 | Ga0123353_10979630 | 3300010167 | Bacteria | 1139 |
| 71 | Ga0456237_0010656 | 3300041968 | Bacteria | 1354 |
| 72 | Ga0466693_036457 | 3300042592 | Bacteria | 20135 |
| 73 | Ga0466691_091314 | 3300042593 | Bacteria | 7514 |
| 74 | Ga0466699_169977 | 3300042597 | Bacteria | 8838 |
| 75 | Ga0466700_111240 | 3300042600 | Bacteria | 2049 |
| 76 | Ga0466722_067278 | 3300042609 | Bacteria | 1570 |
| 77 | Ga0466712_062451 | 3300042614 | Bacteria | 9485 |
| 78 | Ga0466711_030200 | 3300042615 | Bacteria | 9456 |
| 79 | Ga0466723_209976 | 3300042618 | Bacteria | 5978 |
| 80 | Ga0466723_292498 | 3300042618 | Bacteria | 3125 |
| 81 | Ga0466726_126559 | 3300042619 | Unclassified | 7782 |
| 82 | Ga0466728_217427 | 3300042620 | Bacteria | 15359 |
| 83 | JGI24698J34947_10000195 | 3300002449 | Bacteria | 24539 |
| 84 | JGI24698J34947_10004199 | 3300002449 | Bacteria | 7831 |
| 85 | JGI24698J34947_10008798 | 3300002449 | Bacteria | 5537 |
| 86 | JGI24698J34947_10018864 | 3300002449 | Bacteria | 3724 |
| 87 | Ga0466705_044428 | 3300042612 | Bacteria | 3986 |
| 88 | Ga0466705_146047 | 3300042612 | Bacteria | 8415 |
| 89 | Ga0466705_154988 | 3300042612 | Bacteria | 4632 |
| 90 | Ga0466732_238551 | 3300042656 | Bacteria | 2317 |
| 91 | Ga0466703_132686 | 3300042636 | Bacteria | 3305 |
| 92 | Ga0466704_242271 | 3300042643 | Bacteria | 3014 |
| 93 | Ga0466709_229798 | 3300042648 | Bacteria | 12445 |
| 94 | Ga0466708_218194 | 3300042652 | Bacteria | 3165 |
| 95 | Ga0466727_110030 | 3300042655 | Bacteria | 6046 |
| 96 | Ga0466690_341481 | 3300042590 | Unclassified | 6723 |
| 97 | Ga0466690_395441 | 3300042590 | Bacteria | 1592 |
| 98 | Ga0466692_158500 | 3300042591 | Bacteria | 8006 |
| 99 | Ga0466691_105088 | 3300042593 | Bacteria | 4814 |
| 100 | Ga0466694_086413 | 3300042594 | Bacteria | 3433 |
| 101 | Ga0466696_213613 | 3300042596 | Bacteria | 4265 |
| 102 | Ga0466700_124055 | 3300042600 | Bacteria | 1862 |
| 103 | Ga0466716_027376 | 3300042605 | Bacteria | 6232 |
| 104 | Ga0466716_247556 | 3300042605 | Bacteria | 5657 |
| 105 | Ga0466716_364395 | 3300042605 | Bacteria | 2068 |
| 106 | Ga0466716_525054 | 3300042605 | Bacteria | 1661 |
| 107 | Ga0466722_120713 | 3300042609 | Bacteria | 23735 |
| 108 | Ga0466712_058877 | 3300042614 | Bacteria | 25182 |
| 109 | Ga0466711_073694 | 3300042615 | Bacteria | 1840 |
| 110 | Ga0466715_022857 | 3300042616 | Bacteria | 7901 |
| 111 | Ga0466718_053847 | 3300042617 | Bacteria | 7652 |
| 112 | Ga0466723_056195 | 3300042618 | Bacteria | 3840 |
| 113 | Ga0466723_204079 | 3300042618 | Bacteria | 8093 |
| 114 | JGI24698J34947_10002270 | 3300002449 | Bacteria | 10308 |
| 115 | Ga0072941_1005290 | 3300005201 | Bacteria | 15986 |
| 116 | Ga0466729_212381 | 3300042621 | Bacteria | 1486 |
| 117 | Ga0466703_066767 | 3300042636 | Bacteria | 8797 |
| 118 | Ga0466703_076898 | 3300042636 | Bacteria | 76177 |
| 119 | Ga0466703_185995 | 3300042636 | Bacteria | 5938 |
| 120 | Ga0466703_433291 | 3300042636 | Bacteria | 24943 |
| 121 | Ga0466704_322932 | 3300042643 | Bacteria | 9266 |
| 122 | Ga0466704_347499 | 3300042643 | Bacteria | 2701 |
| 123 | Ga0466709_194846 | 3300042648 | Bacteria | 7188 |
| 124 | Ga0466709_376652 | 3300042648 | Bacteria | 2143 |
| 125 | Ga0466708_006069 | 3300042652 | Bacteria | 10661 |
| 126 | Ga0466708_417541 | 3300042652 | Bacteria | 43144 |
| 127 | Ga0466708_426990 | 3300042652 | Bacteria | 20710 |
| 128 | Ga0466727_167693 | 3300042655 | Bacteria | 2575 |
| 129 | Ga0123353_10235733 | 3300010167 | Bacteria | 2848 |
| 130 | Ga0466690_044900 | 3300042590 | Bacteria | 17921 |
| 131 | Ga0466695_162681 | 3300042595 | Bacteria | 8790 |
| 132 | Ga0466696_211883 | 3300042596 | Bacteria | 5088 |
| 133 | Ga0466696_385616 | 3300042596 | Bacteria | 5814 |
| 134 | Ga0466699_208291 | 3300042597 | Bacteria | 1630 |
| 135 | Ga0466707_087831 | 3300042601 | Bacteria | 2366 |
| 136 | Ga0466719_198832 | 3300042606 | Bacteria | 3345 |
| 137 | Ga0466719_288816 | 3300042606 | Bacteria | 4782 |
| 138 | Ga0466719_403685 | 3300042606 | Bacteria | 1420 |
| 139 | Ga0466722_018865 | 3300042609 | Bacteria | 10970 |
| 140 | Ga0466705_474941 | 3300042612 | Bacteria | 29700 |
| 141 | Ga0466715_210163 | 3300042616 | Bacteria | 48320 |
| 142 | Ga0466728_207140 | 3300042620 | Bacteria | 11170 |
| 143 | JGI24698J34947_10015678 | 3300002449 | Unclassified | 4122 |
| 144 | JGI24698J34947_10027810 | 3300002449 | Bacteria | 2999 |
| 145 | JGI24702J35022_10000854 | 3300002462 | Bacteria | 18852 |
| 146 | Ga0466704_012354 | 3300042643 | Bacteria | 2211 |
| 147 | Ga0466704_173997 | 3300042643 | Bacteria | 7270 |
| 148 | Ga0466704_381443 | 3300042643 | Bacteria | 9348 |
| 149 | Ga0466727_061194 | 3300042655 | Bacteria | 25961 |
| 150 | Ga0466727_140506 | 3300042655 | Bacteria | 2269 |
| 151 | Ga0123353_11004974 | 3300010167 | Bacteria | 1120 |
| 152 | Ga0264413_111293 | 3300024493 | Bacteria | 11175 |
| 153 | Ga0466690_145072 | 3300042590 | Bacteria | 4878 |
| 154 | Ga0466690_400616 | 3300042590 | Bacteria | 1990 |
| 155 | Ga0466692_079555 | 3300042591 | Unclassified | 2583 |
| 156 | Ga0466692_079793 | 3300042591 | Bacteria | 14479 |
| 157 | Ga0466691_033478 | 3300042593 | Bacteria | 3824 |
| 158 | Ga0466694_188429 | 3300042594 | Bacteria | 57168 |
| 159 | Ga0466694_279106 | 3300042594 | Bacteria | 2348 |
| 160 | Ga0466706_260895 | 3300042599 | Bacteria | 7181 |
| 161 | Ga0466722_025146 | 3300042609 | Bacteria | 6377 |
| 162 | Ga0466712_066625 | 3300042614 | Bacteria | 1895 |
| 163 | Ga0466715_053951 | 3300042616 | Bacteria | 20752 |
| 164 | Ga0466715_067308 | 3300042616 | Bacteria | 4420 |
| 165 | Ga0466718_049854 | 3300042617 | Unclassified | 2833 |
| 166 | Ga0466726_268006 | 3300042619 | Bacteria | 14662 |
| 167 | Ga0466726_343321 | 3300042619 | Bacteria | 1743 |
| 168 | JGI24698J34947_10000521 | 3300002449 | Bacteria | 18150 |
| 169 | JGI24698J34947_10007605 | 3300002449 | Bacteria | 5956 |
| 170 | JGI24698J34947_10014255 | 3300002449 | Bacteria | 4328 |
| 171 | JGI24702J35022_10039540 | 3300002462 | Bacteria | 2516 |
| 172 | JGI24702J35022_10067943 | 3300002462 | Bacteria | 1915 |
| 173 | Ga0068305_10025194 | 3300005083 | Bacteria | 16801 |
| 174 | Ga0466705_050485 | 3300042612 | Bacteria | 7423 |
| 175 | Ga0466705_196488 | 3300042612 | Bacteria | 6297 |
| 176 | Ga0466732_100504 | 3300042656 | Bacteria | 7132 |
| 177 | Ga0466703_026456 | 3300042636 | Bacteria | 8006 |
| 178 | Ga0466703_364328 | 3300042636 | Bacteria | 4874 |
| 179 | Ga0466704_552175 | 3300042643 | Bacteria | 3805 |
| 180 | Ga0466709_206117 | 3300042648 | Bacteria | 1210 |
| 181 | Ga0466709_356593 | 3300042648 | Bacteria | 6710 |
| 182 | Ga0466708_120289 | 3300042652 | Bacteria | 12515 |
| 183 | Ga0466708_333299 | 3300042652 | Bacteria | 1533 |
| 184 | Ga0466727_235316 | 3300042655 | Bacteria | 6867 |
| 185 | Ga0123357_10209146 | 3300009784 | Bacteria | 2197 |
| 186 | Ga0123353_10007623 | 3300010167 | Bacteria | 14667 |
| 187 | Ga0466690_028902 | 3300042590 | Bacteria | 2190 |
| 188 | Ga0466691_130702 | 3300042593 | Bacteria | 35179 |
| 189 | Ga0466691_137511 | 3300042593 | Bacteria | 3468 |
| 190 | Ga0466694_144469 | 3300042594 | Bacteria | 1926 |
| 191 | Ga0466713_040273 | 3300042602 | Bacteria | 1815 |
| 192 | Ga0466713_065048 | 3300042602 | Bacteria | 4678 |
| 193 | Ga0466720_087531 | 3300042607 | Bacteria | 9926 |
| 194 | Ga0466722_011431 | 3300042609 | Bacteria | 3513 |
| 195 | Ga0466698_039739 | 3300042610 | Bacteria | 2293 |
| 196 | Ga0466715_001062 | 3300042616 | Bacteria | 1799 |
| 197 | Ga0466715_091879 | 3300042616 | Bacteria | 83726 |
| 198 | Ga0466718_043885 | 3300042617 | Unclassified | 1951 |
| 199 | Ga0466718_119801 | 3300042617 | Bacteria | 6113 |
| 200 | Ga0466729_008786 | 3300042621 | Bacteria | 1277 |
| 201 | Ga0072940_1203681 | 3300005200 | Unclassified | 2930 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF10502 | Peptidase_S26 | Signal peptidase, peptidase S26 | 86 | 212 | 0.96 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.