Protein Family IF08584
Metagenome
Isolate
141
Members
39
Samples
128
Scaffolds
142.9
Avg Length
Representative Sequence
- ID
- 3300042622|Ga0466731_056937|Ga0466731_056937_2138_2587
- Length
- 149 aa
- Sequence
- LETKKQGEKMNLELFLNFNGNCRESLEFYSKVFKSDINNLMTYGQMPPDPNLDTVIEADKEKVMYAGLVIGGTTVMFCDMPSDSPLIVGNNINPTLSMNNKEEITNIFNELKNGGEVYMELQQTFFSELYGMVKDKFGIIWQILFYDRG
Sample Types
Isolate
9.2%
Metagenome
90.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
61.5%
Unclassified
33.3%
Kalotermitidae
2.6%
Termopsidae
2.6%
Taxonomy
Archaea
38
Bacteria
80
Eukaryota
0
Viruses
0
Unclassified
23
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820348946 | Unclassified Firmicutes Nt197P3bin47 | Isolate | Unclassified |
| 2 | 2820350530 | Unclassified Firmicutes Nt197P3bin37 | Isolate | Unclassified |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 5 | 2781125653 | Treponema sp. Emb289P1bin107 | Isolate | Unclassified |
| 6 | 2820626145 | Unclassified Firmicutes Emb289P1bin123 | Isolate | Unclassified |
| 7 | 2772190990 | Unclassified Bathyarchaeota Emb289P1bin127 | Isolate | Unclassified |
| 8 | 2820457604 | Unclassified Firmicutes Lab288P3bin15 | Isolate | Unclassified |
| 9 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 10 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 11 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 14 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 15 | 2820353569 | Unclassified Firmicutes Nt197P3bin28 | Isolate | Unclassified |
| 16 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 17 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 18 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 19 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 20 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 21 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 22 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 23 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 24 | 2820240463 | Unclassified Firmicutes Th196P3bin85 | Isolate | Unclassified |
| 25 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 26 | 2820639607 | Unclassified Firmicutes Cu122P5bin9 | Isolate | Unclassified |
| 27 | 2772190991 | Unclassified Bathyarchaeota Emb289P3bin109 | Isolate | Unclassified |
| 28 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 29 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 30 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 31 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 32 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 33 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 34 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 35 | 2820607737 | Unclassified Firmicutes Emb289P1bin48 | Isolate | Unclassified |
| 36 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 37 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 38 | 2820312173 | Unclassified Firmicutes Nt197P4bin8 | Isolate | Unclassified |
| 39 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24705J35276_12238042 | 3300002504 | Unclassified | 15242 |
| 2 | Ga0123357_10373559 | 3300009784 | Archaea | 1333 |
| 3 | Ga0123355_10092321 | 3300009826 | Unclassified | 4796 |
| 4 | Ga0123356_11498318 | 3300010049 | Archaea | 832 |
| 5 | Ga0123356_13130987 | 3300010049 | Archaea | 576 |
| 6 | Ga0123353_10177325 | 3300010167 | Bacteria | 3378 |
| 7 | Ga0123353_10294666 | 3300010167 | Unclassified | 2481 |
| 8 | Ga0123353_10412043 | 3300010167 | Bacteria | 2006 |
| 9 | Ga0466714_017740 | 3300042603 | Bacteria | 1685 |
| 10 | Ga0466731_055489 | 3300042622 | Unclassified | 2855 |
| 11 | Ga0466731_343035 | 3300042622 | Bacteria | 3543 |
| 12 | Ga0466734_111133 | 3300042623 | Bacteria | 1061 |
| 13 | Ga0466725_465317 | 3300042654 | Unclassified | 1039 |
| 14 | Ga0466656_343518 | 3300042550 | Bacteria | 8765 |
| 15 | Ga0466697_189702 | 3300042611 | Bacteria | 15862 |
| 16 | Ga0466697_279290 | 3300042611 | Bacteria | 1609 |
| 17 | JGI24705J35276_12206861 | 3300002504 | Unclassified | 1731 |
| 18 | JGI24705J35276_12234784 | 3300002504 | Bacteria | 5840 |
| 19 | Ga0123355_10373391 | 3300009826 | Bacteria | 1865 |
| 20 | Ga0123356_10382793 | 3300010049 | Bacteria | 1540 |
| 21 | Ga0123356_10979708 | 3300010049 | Archaea | 1016 |
| 22 | Ga0123356_12131968 | 3300010049 | Archaea | 700 |
| 23 | Ga0123353_10007417 | 3300010167 | Bacteria | 14811 |
| 24 | Ga0123353_10218059 | 3300010167 | Bacteria | 2987 |
| 25 | Ga0123353_11670219 | 3300010167 | Archaea | 800 |
| 26 | Ga0123354_10250181 | 3300010882 | Bacteria | 1798 |
| 27 | Ga0466700_041410 | 3300042600 | Bacteria | 1234 |
| 28 | Ga0466700_171924 | 3300042600 | Unclassified | 1164 |
| 29 | Ga0466721_222650 | 3300042608 | Archaea | 1442 |
| 30 | Ga0466703_243918 | 3300042636 | Bacteria | 7301 |
| 31 | Ga0466657_068524 | 3300042582 | Bacteria | 2612 |
| 32 | Ga0466657_289878 | 3300042582 | Bacteria | 2618 |
| 33 | JGI24705J35276_12203773 | 3300002504 | Bacteria | 1663 |
| 34 | JGI24705J35276_12238485 | 3300002504 | Bacteria | 23721 |
| 35 | Ga0123355_10159303 | 3300009826 | Bacteria | 3405 |
| 36 | Ga0123356_10000489 | 3300010049 | Unclassified | 44148 |
| 37 | Ga0123353_10218773 | 3300010167 | Bacteria | 2981 |
| 38 | Ga0123353_10234980 | 3300010167 | Bacteria | 2854 |
| 39 | Ga0123353_10529814 | 3300010167 | Unclassified | 1706 |
| 40 | Ga0466701_075701 | 3300042598 | Bacteria | 1681 |
| 41 | Ga0466701_087404 | 3300042598 | Bacteria | 17906 |
| 42 | Ga0466717_261691 | 3300042604 | Bacteria | 2690 |
| 43 | Ga0466697_047479 | 3300042611 | Bacteria | 73888 |
| 44 | Ga0466731_294069 | 3300042622 | Bacteria | 2516 |
| 45 | Ga0466734_031336 | 3300042623 | Archaea | 1147 |
| 46 | Ga0466727_162903 | 3300042655 | Bacteria | 2550 |
| 47 | Ga0466718_146305 | 3300042617 | Archaea | 1070 |
| 48 | Ga0415639_157783 | 3300038395 | Unclassified | 2314 |
| 49 | Ga0466656_117942 | 3300042550 | Archaea | 4136 |
| 50 | Ga0466657_078821 | 3300042582 | Bacteria | 6559 |
| 51 | Ga0466694_348007 | 3300042594 | Bacteria | 2191 |
| 52 | JGI24702J35022_10017166 | 3300002462 | Bacteria | 3959 |
| 53 | Ga0123355_11655694 | 3300009826 | Archaea | 613 |
| 54 | Ga0123356_10363459 | 3300010049 | Archaea | 1575 |
| 55 | Ga0123353_11588000 | 3300010167 | Archaea | 827 |
| 56 | Ga0466731_056937 | 3300042622 | Bacteria | 2844 |
| 57 | Ga0466731_072061 | 3300042622 | Bacteria | 3870 |
| 58 | Ga0466731_254576 | 3300042622 | Archaea | 1535 |
| 59 | Ga0466657_308119 | 3300042582 | Bacteria | 1622 |
| 60 | Ga0466694_190416 | 3300042594 | Bacteria | 2687 |
| 61 | Ga0466694_403216 | 3300042594 | Unclassified | 1997 |
| 62 | Ga0466697_121971 | 3300042611 | Bacteria | 12077 |
| 63 | Ga0466733_189701 | 3300042659 | Bacteria | 6576 |
| 64 | Ga0123355_10808728 | 3300009826 | Unclassified | 1043 |
| 65 | Ga0123356_10005057 | 3300010049 | Bacteria | 13516 |
| 66 | Ga0123353_10000609 | 3300010167 | Bacteria | 43769 |
| 67 | Ga0123353_10535861 | 3300010167 | Archaea | 1693 |
| 68 | Ga0123353_11227414 | 3300010167 | Archaea | 981 |
| 69 | Ga0123354_10000047 | 3300010882 | Bacteria | 92241 |
| 70 | Ga0123354_10660057 | 3300010882 | Archaea | 744 |
| 71 | Ga0466700_139498 | 3300042600 | Unclassified | 1577 |
| 72 | Ga0466721_081166 | 3300042608 | Bacteria | 1144 |
| 73 | Ga0466734_104842 | 3300042623 | Bacteria | 1410 |
| 74 | Ga0466734_117719 | 3300042623 | Bacteria | 6272 |
| 75 | Ga0466657_270574 | 3300042582 | Bacteria | 10552 |
| 76 | Ga0466694_014354 | 3300042594 | Unclassified | 1226 |
| 77 | Ga0466695_035402 | 3300042595 | Archaea | 1696 |
| 78 | Ga0123356_11013605 | 3300010049 | Archaea | 1000 |
| 79 | Ga0123356_11379366 | 3300010049 | Archaea | 866 |
| 80 | Ga0123356_12490453 | 3300010049 | Archaea | 648 |
| 81 | Ga0123356_13218145 | 3300010049 | Archaea | 568 |
| 82 | Ga0123353_10006645 | 3300010167 | Bacteria | 15449 |
| 83 | Ga0123353_10511945 | 3300010167 | Bacteria | 1745 |
| 84 | Ga0123353_11018215 | 3300010167 | Archaea | 1111 |
| 85 | Ga0123353_11137835 | 3300010167 | Archaea | 1032 |
| 86 | Ga0123353_11367232 | 3300010167 | Archaea | 913 |
| 87 | Ga0466701_068163 | 3300042598 | Bacteria | 1482 |
| 88 | Ga0466701_097096 | 3300042598 | Bacteria | 15290 |
| 89 | Ga0466700_481418 | 3300042600 | Bacteria | 1371 |
| 90 | Ga0466714_035994 | 3300042603 | Unclassified | 1218 |
| 91 | Ga0466717_038736 | 3300042604 | Unclassified | 1035 |
| 92 | Ga0466656_272526 | 3300042550 | Bacteria | 4744 |
| 93 | Ga0466657_391581 | 3300042582 | Bacteria | 4912 |
| 94 | Ga0466695_013563 | 3300042595 | Unclassified | 1162 |
| 95 | Ga0123355_10011913 | 3300009826 | Bacteria | 13439 |
| 96 | Ga0123355_10621101 | 3300009826 | Unclassified | 1274 |
| 97 | Ga0123356_10064132 | 3300010049 | Bacteria | 3434 |
| 98 | Ga0123353_10007427 | 3300010167 | Bacteria | 14801 |
| 99 | Ga0123353_11659968 | 3300010167 | Archaea | 803 |
| 100 | Ga0123353_12274755 | 3300010167 | Archaea | 653 |
| 101 | Ga0123354_10091681 | 3300010882 | Bacteria | 4195 |
| 102 | Ga0466701_019361 | 3300042598 | Bacteria | 22343 |
| 103 | Ga0466700_360114 | 3300042600 | Bacteria | 1231 |
| 104 | Ga0466714_077346 | 3300042603 | Archaea | 1407 |
| 105 | Ga0466731_173067 | 3300042622 | Archaea | 3383 |
| 106 | Ga0466656_325522 | 3300042550 | Unclassified | 1558 |
| 107 | Ga0466697_197472 | 3300042611 | Bacteria | 1572 |
| 108 | Ga0466733_155015 | 3300042659 | Archaea | 1296 |
| 109 | Ga0123356_10234200 | 3300010049 | Bacteria | 1903 |
| 110 | Ga0123353_10134418 | 3300010167 | Bacteria | 3967 |
| 111 | Ga0123353_10324559 | 3300010167 | Bacteria | 2334 |
| 112 | Ga0123353_10486973 | 3300010167 | Unclassified | 1802 |
| 113 | Ga0123353_10488053 | 3300010167 | Archaea | 1800 |
| 114 | Ga0123353_10677703 | 3300010167 | Archaea | 1453 |
| 115 | Ga0123353_10719631 | 3300010167 | Archaea | 1396 |
| 116 | Ga0123353_11538131 | 3300010167 | Bacteria | 845 |
| 117 | Ga0123354_10177753 | 3300010882 | Unclassified | 2444 |
| 118 | Ga0466701_053727 | 3300042598 | Bacteria | 58706 |
| 119 | Ga0466700_175565 | 3300042600 | Archaea | 1408 |
| 120 | Ga0466714_007982 | 3300042603 | Bacteria | 9139 |
| 121 | Ga0466714_024864 | 3300042603 | Archaea | 1134 |
| 122 | Ga0466714_149574 | 3300042603 | Bacteria | 20039 |
| 123 | Ga0466731_055527 | 3300042622 | Archaea | 1110 |
| 124 | Ga0466725_138844 | 3300042654 | Bacteria | 7132 |
| 125 | Ga0466710_426118 | 3300042613 | Bacteria | 4057 |
| 126 | Ga0466694_029396 | 3300042594 | Bacteria | 23628 |
| 127 | Ga0466694_167924 | 3300042594 | Unclassified | 4954 |
| 128 | Ga0466694_211270 | 3300042594 | Unclassified | 20551 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.