Protein Family IF08582

Metagenome Isolate
117 Members
31 Samples
102 Scaffolds
178.32 Avg Length

🧬 Representative Sequence

ID
3300042622|Ga0466731_055191|Ga0466731_055191_952_1602
Length
216 aa
Sequence
MLFSPTVYIRYLTNKGKQAKINILKVINFLKYNMEYNMDFFEVVEKRYSHKEKFLPEAVPLKHLELIAKAGLAAPTGNNSQYVRLIILPDRMSLQPLCDIAPTDGMFTAPAAIAVLTDPSAQKYEWNFETEDYSAAAAQMLLAATALGYVSLWLDSPYFDEAKQKAALSVLGVPEDYHLRVVLPIGLPDGEGTRREKMAFNERVSYRKFGAAENHK

📊 Sample Types

Isolate 12.8%
Metagenome 87.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 48.4%
Termitidae 45.2%
Passalidae 6.5%

🌳 Taxonomy

Archaea 0
Bacteria 108
Eukaryota 0
Viruses 1
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
2 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
3 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
4 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
5 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
6 2820587002 Unclassified Firmicutes Emb289P1bin94 Isolate Unclassified
7 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
8 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
9 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
10 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
11 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
12 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
13 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
14 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
15 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
16 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
17 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
18 2820342392 Unclassified Firmicutes Nt197P3bin64 Isolate Unclassified
19 2820387566 Unclassified Firmicutes Nt197P1bin1 Isolate Unclassified
20 2820570671 Unclassified Firmicutes Emb289P3bin19 Isolate Unclassified
21 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
22 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
23 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
24 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
25 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
26 2820666966 Unclassified Firmicutes Co191P3bin39 Isolate Unclassified
27 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
28 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
29 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
30 2820442516 Unclassified Firmicutes Lab288P3bin200 Isolate Unclassified
31 2820551407 Unclassified Firmicutes Emb289P4bin38 Isolate Unclassified

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0415639_006684 3300038395 Bacteria 20735
2 Ga0415639_042887 3300038395 Bacteria 10064
3 Ga0415639_275359 3300038395 Bacteria 1902
4 Ga0466694_229612 3300042594 Bacteria 2124
5 Ga0123356_10045172 3300010049 Bacteria 4099
6 Ga0123356_10097462 3300010049 Bacteria 2814
7 Ga0123356_12238751 3300010049 Bacteria 683
8 Ga0123356_12584242 3300010049 Bacteria 636
9 Ga0123353_10023831 3300010167 Bacteria 9273
10 JGI24695J34938_10000450 3300002450 Bacteria 39866
11 JGI24695J34938_10021696 3300002450 Bacteria 3136
12 JGI24695J34938_10023399 3300002450 Bacteria 2979
13 Ga0466731_367617 3300042622 Bacteria 1201
14 Ga0415639_022445 3300038395 Bacteria 7378
15 Ga0415639_055946 3300038395 Bacteria 4725
16 Ga0123356_10000052 3300010049 Bacteria 124725
17 Ga0123356_10001220 3300010049 Bacteria 28562
18 Ga0123356_10475153 3300010049 Bacteria 1402
19 Ga0466714_001523 3300042603 Bacteria 39207
20 IMNBL1DRAFT_c0000090 3300000062 Bacteria 79466
21 JGI24695J34938_10000040 3300002450 Bacteria 97045
22 JGI24695J34938_10021364 3300002450 Bacteria 3168
23 JGI24703J35330_11748849 3300002501 Bacteria 49103
24 Ga0466694_323111 3300042594 Bacteria 13478
25 Ga0466699_238241 3300042597 Unclassified 1052
26 Ga0123355_10003565 3300009826 Bacteria 22382
27 Ga0123355_10309667 3300009826 Unclassified 2142
28 Ga0123356_10000993 3300010049 Bacteria 31501
29 Ga0123356_10040477 3300010049 Bacteria 4342
30 Ga0123356_10231051 3300010049 Bacteria 1914
31 Ga0123356_10513086 3300010049 Bacteria 1356
32 Ga0123353_10630650 3300010167 Bacteria 1523
33 Ga0123353_10840887 3300010167 Bacteria 1260
34 Ga0123353_12155721 3300010167 Bacteria 676
35 Ga0466731_344606 3300042622 Bacteria 1207
36 Ga0415639_012862 3300038395 Bacteria 2754
37 Ga0415639_015544 3300038395 Bacteria 3751
38 Ga0466694_041802 3300042594 Viruses 1433
39 Ga0123356_10003085 3300010049 Bacteria 17599
40 Ga0123356_10019418 3300010049 Bacteria 6442
41 Ga0123356_10023021 3300010049 Bacteria 5871
42 Ga0123356_10175249 3300010049 Bacteria 2160
43 Ga0123353_10427449 3300010167 Bacteria 1960
44 Ga0123353_10530157 3300010167 Bacteria 1705
45 JGI24695J34938_10000032 3300002450 Bacteria 104156
46 JGI24695J34938_10002650 3300002450 Bacteria 13353
47 Ga0466694_017424 3300042594 Unclassified 1012
48 Ga0466694_043158 3300042594 Bacteria 2978
49 Ga0123356_10070840 3300010049 Bacteria 3271
50 Ga0123356_10739922 3300010049 Bacteria 1153
51 Ga0123356_11003352 3300010049 Bacteria 1005
52 Ga0123353_10370124 3300010167 Bacteria 2149
53 Ga0466700_050722 3300042600 Bacteria 1397
54 Ga0466698_341219 3300042610 Bacteria 3817
55 JGI24695J34938_10027890 3300002450 Bacteria 2662
56 Ga0123355_10436328 3300009826 Bacteria 1662
57 Ga0123356_10016156 3300010049 Bacteria 7129
58 Ga0123356_10041498 3300010049 Bacteria 4286
59 Ga0123356_10148914 3300010049 Bacteria 2321
60 Ga0123356_10177070 3300010049 Bacteria 2150
61 Ga0123356_10911808 3300010049 Bacteria 1050
62 Ga0123353_10000299 3300010167 Bacteria 61883
63 Ga0123353_10265358 3300010167 Unclassified 2649
64 Ga0466700_418552 3300042600 Bacteria 1753
65 Ga0466721_395007 3300042608 Bacteria 1359
66 Ga0466698_297353 3300042610 Unclassified 1119
67 Ga0466698_487865 3300042610 Bacteria 1889
68 JGI24695J34938_10000223 3300002450 Bacteria 53945
69 JGI24695J34938_10001359 3300002450 Bacteria 21149
70 JGI24695J34938_10002645 3300002450 Unclassified 13364
71 Ga0466731_055191 3300042622 Bacteria 1847
72 Ga0415639_007395 3300038395 Bacteria 2955
73 Ga0415639_031847 3300038395 Bacteria 18445
74 Ga0415639_034025 3300038395 Bacteria 7867
75 Ga0415639_064193 3300038395 Bacteria 2771
76 Ga0466693_302025 3300042592 Bacteria 1375
77 Ga0123355_10001633 3300009826 Bacteria 31292
78 Ga0123355_10007773 3300009826 Bacteria 16131
79 Ga0123355_10171649 3300009826 Unclassified 3240
80 Ga0123355_10314775 3300009826 Bacteria 2117
81 Ga0123355_10621907 3300009826 Bacteria 1272
82 Ga0123353_10465890 3300010167 Bacteria 1855
83 IMNBL1DRAFT_c0000026 3300000062 Bacteria 139385
84 IMNBL1DRAFT_c0000046 3300000062 Bacteria 114325
85 JGI24695J34938_10079215 3300002450 Bacteria 1359
86 JGI24695J34938_10084487 3300002450 Unclassified 1308
87 JGI24695J34938_10173708 3300002450 Bacteria 890
88 Ga0415639_001189 3300038395 Bacteria 1006
89 Ga0466693_392948 3300042592 Bacteria 1659
90 Ga0466699_036553 3300042597 Bacteria 5573
91 Ga0123355_10025665 3300009826 Bacteria 9488
92 Ga0123355_10397219 3300009826 Bacteria 1782
93 Ga0123356_10053567 3300010049 Bacteria 3756
94 Ga0123356_10104335 3300010049 Bacteria 2725
95 Ga0123356_10704779 3300010049 Bacteria 1179
96 Ga0123353_10678468 3300010167 Bacteria 1452
97 Ga0466714_013432 3300042603 Bacteria 1851
98 Ga0466721_098321 3300042608 Bacteria 47861
99 2227490759 2225789004 Bacteria 4089
100 JGI24695J34938_10007490 3300002450 Bacteria 6383
101 JGI24695J34938_10015439 3300002450 Bacteria 3920
102 Ga0466731_196144 3300042622 Bacteria 18598

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00881 Nitroreductase Nitroreductase family 45 88 0.92

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.