Protein Family IF08562
Metagenome
Metatranscriptome
Isolate
164
Members
55
Samples
154
Scaffolds
172.52
Avg Length
Representative Sequence
- ID
- 3300042621|Ga0466729_265539|Ga0466729_265539_52_633
- Length
- 193 aa
- Sequence
- MSGNNVRRKKDKFNKREESMCENCNCQQGSVADFSSLAPVIEKYGKVQGSLITILQKAQDIYGYLSIDAINYISEKTGIKPAKIYGVATFYTQFRLKPIGKNLIMLCKGTACHVNGADAIEEAITEFLEIQDGETTADGIFTLNNVACLGCCSLAPVMMIKNAEGEETFGNLTKDTAKAILAEMRQREQEVAV
Sample Types
Isolate
6.1%
Metagenome
93.3%
MAG
0.0%
Metatranscriptome
0.6%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.2%
Kalotermitidae
25.5%
Unclassified
23.6%
Rhinotermitidae
5.5%
Termopsidae
5.5%
Hodotermitidae
1.8%
Taxonomy
Archaea
1
Bacteria
149
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820447167 | Unclassified Firmicutes Lab288P3bin192 | Isolate | Unclassified |
| 2 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 3 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 7 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 8 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 9 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 10 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 11 | 2820362221 | Unclassified Firmicutes Nt197P3bin116 | Isolate | Unclassified |
| 12 | 2820424542 | Unclassified Firmicutes Lab288P3bin47 | Isolate | Unclassified |
| 13 | 2820464928 | Unclassified Firmicutes Lab288P3bin121 | Isolate | Unclassified |
| 14 | 2820535361 | Unclassified Firmicutes Lab288P1bin14 | Isolate | Unclassified |
| 15 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 16 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 17 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 18 | 3300021245 | Termite gut microbial communities from nest from French Guiana - 11-4 mRNA SA | Metatranscriptome | Termitidae |
| 19 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 20 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 21 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 22 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 23 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 24 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 25 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 26 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 27 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 28 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 29 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 30 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 31 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 32 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 33 | 2820336130 | Unclassified Firmicutes Nt197P3bin70 | Isolate | Unclassified |
| 34 | 2820444930 | Unclassified Firmicutes Lab288P3bin199 | Isolate | Unclassified |
| 35 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 36 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 37 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 38 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 39 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 40 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 41 | 2820280018 | Unclassified Firmicutes Th196P3bin149 | Isolate | Unclassified |
| 42 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 43 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 44 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 45 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 46 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 47 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 48 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 49 | 2820412446 | Unclassified Firmicutes Lab288P4bin39 | Isolate | Unclassified |
| 50 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 51 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 52 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 53 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 54 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 55 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_136074 | 3300042612 | Bacteria | 25520 |
| 2 | Ga0466705_382835 | 3300042612 | Bacteria | 6171 |
| 3 | Ga0466715_069964 | 3300042616 | Bacteria | 11401 |
| 4 | Ga0123355_10100364 | 3300009826 | Bacteria | 4559 |
| 5 | Ga0123355_10122941 | 3300009826 | Unclassified | 4021 |
| 6 | Ga0123355_11533145 | 3300009826 | Bacteria | 647 |
| 7 | Ga0123356_10002890 | 3300010049 | Bacteria | 18193 |
| 8 | Ga0123356_10074472 | 3300010049 | Bacteria | 3195 |
| 9 | Ga0123356_10079256 | 3300010049 | Bacteria | 3102 |
| 10 | Ga0123356_10362656 | 3300010049 | Bacteria | 1576 |
| 11 | Ga0123356_10883146 | 3300010049 | Bacteria | 1065 |
| 12 | Ga0123353_10000354 | 3300010167 | Bacteria | 56099 |
| 13 | Ga0466708_073980 | 3300042652 | Bacteria | 4188 |
| 14 | Ga0466708_332359 | 3300042652 | Bacteria | 17952 |
| 15 | Ga0466725_248854 | 3300042654 | Bacteria | 4821 |
| 16 | Ga0466701_075754 | 3300042598 | Bacteria | 3418 |
| 17 | Ga0466706_283517 | 3300042599 | Bacteria | 6631 |
| 18 | Ga0466700_386969 | 3300042600 | Bacteria | 1277 |
| 19 | Ga0466707_203754 | 3300042601 | Bacteria | 3665 |
| 20 | Ga0466721_043150 | 3300042608 | Unclassified | 2151 |
| 21 | Ga0466691_062393 | 3300042593 | Bacteria | 1405 |
| 22 | Ga0466696_269050 | 3300042596 | Bacteria | 2991 |
| 23 | Ga0068305_10207522 | 3300005083 | Bacteria | 8971 |
| 24 | Ga0466715_474817 | 3300042616 | Bacteria | 2169 |
| 25 | Ga0466728_027037 | 3300042620 | Bacteria | 10383 |
| 26 | Ga0123357_10414087 | 3300009784 | Bacteria | 1211 |
| 27 | Ga0123355_10133225 | 3300009826 | Bacteria | 3824 |
| 28 | Ga0123355_10148815 | 3300009826 | Bacteria | 3562 |
| 29 | Ga0123356_10031024 | 3300010049 | Bacteria | 5002 |
| 30 | Ga0123356_10825903 | 3300010049 | Bacteria | 1098 |
| 31 | Ga0123353_10116714 | 3300010167 | Bacteria | 4295 |
| 32 | Ga0123353_10211826 | 3300010167 | Bacteria | 3039 |
| 33 | Ga0123353_10406646 | 3300010167 | Bacteria | 2023 |
| 34 | Ga0123353_10470519 | 3300010167 | Bacteria | 1843 |
| 35 | Ga0123354_10079569 | 3300010882 | Unclassified | 4649 |
| 36 | Ga0466703_154051 | 3300042636 | Bacteria | 12754 |
| 37 | Ga0466703_257416 | 3300042636 | Bacteria | 8220 |
| 38 | Ga0466709_379506 | 3300042648 | Bacteria | 2109 |
| 39 | Ga0466708_322579 | 3300042652 | Bacteria | 35124 |
| 40 | Ga0466707_123777 | 3300042601 | Bacteria | 3671 |
| 41 | Ga0466707_409571 | 3300042601 | Bacteria | 70690 |
| 42 | Ga0466713_130503 | 3300042602 | Bacteria | 31469 |
| 43 | Ga0466714_035606 | 3300042603 | Bacteria | 1669 |
| 44 | Ga0223683_1007266 | 3300021245 | Bacteria | 2396 |
| 45 | Ga0466690_155085 | 3300042590 | Bacteria | 1323 |
| 46 | Ga0068305_10924613 | 3300005083 | Bacteria | 833 |
| 47 | Ga0466711_042163 | 3300042615 | Bacteria | 3577 |
| 48 | Ga0466723_069406 | 3300042618 | Bacteria | 2491 |
| 49 | Ga0466726_360933 | 3300042619 | Bacteria | 7935 |
| 50 | Ga0123356_10101606 | 3300010049 | Bacteria | 2759 |
| 51 | Ga0123356_10137796 | 3300010049 | Bacteria | 2402 |
| 52 | Ga0123353_10835553 | 3300010167 | Bacteria | 1265 |
| 53 | Ga0123353_10915719 | 3300010167 | Bacteria | 1191 |
| 54 | Ga0123353_11410961 | 3300010167 | Bacteria | 894 |
| 55 | Ga0123354_10548693 | 3300010882 | Unclassified | 873 |
| 56 | Ga0466704_510167 | 3300042643 | Bacteria | 3388 |
| 57 | Ga0466725_333627 | 3300042654 | Bacteria | 1927 |
| 58 | Ga0466727_273825 | 3300042655 | Bacteria | 7293 |
| 59 | Ga0466707_004051 | 3300042601 | Bacteria | 1678 |
| 60 | Ga0466707_015396 | 3300042601 | Bacteria | 44812 |
| 61 | Ga0466707_263143 | 3300042601 | Bacteria | 2010 |
| 62 | Ga0466714_030563 | 3300042603 | Unclassified | 1238 |
| 63 | Ga0466719_498250 | 3300042606 | Bacteria | 4597 |
| 64 | Ga0466721_015151 | 3300042608 | Bacteria | 16308 |
| 65 | Ga0068302_10151599 | 3300005071 | Unclassified | 3688 |
| 66 | Ga0466697_258164 | 3300042611 | Bacteria | 1090 |
| 67 | Ga0466718_060376 | 3300042617 | Bacteria | 6149 |
| 68 | Ga0123355_10226957 | 3300009826 | Bacteria | 2674 |
| 69 | Ga0123355_10853838 | 3300009826 | Bacteria | 1001 |
| 70 | Ga0123356_10053627 | 3300010049 | Bacteria | 3753 |
| 71 | Ga0123356_10131092 | 3300010049 | Bacteria | 2456 |
| 72 | Ga0123356_10332305 | 3300010049 | Unclassified | 1637 |
| 73 | Ga0123356_10385449 | 3300010049 | Bacteria | 1535 |
| 74 | Ga0123356_10416201 | 3300010049 | Bacteria | 1485 |
| 75 | Ga0123353_10334937 | 3300010167 | Bacteria | 2288 |
| 76 | Ga0123353_10376941 | 3300010167 | Bacteria | 2124 |
| 77 | Ga0123353_11041366 | 3300010167 | Bacteria | 1094 |
| 78 | Ga0123354_10043839 | 3300010882 | Bacteria | 6869 |
| 79 | Ga0123354_10356306 | 3300010882 | Bacteria | 1297 |
| 80 | Ga0466703_305192 | 3300042636 | Bacteria | 6007 |
| 81 | Ga0466704_128107 | 3300042643 | Bacteria | 1361 |
| 82 | Ga0466704_264752 | 3300042643 | Unclassified | 5469 |
| 83 | Ga0466706_197604 | 3300042599 | Bacteria | 3796 |
| 84 | Ga0466700_210474 | 3300042600 | Bacteria | 75558 |
| 85 | Ga0466707_178948 | 3300042601 | Bacteria | 22633 |
| 86 | Ga0466722_085278 | 3300042609 | Bacteria | 2319 |
| 87 | Ga0466722_258932 | 3300042609 | Bacteria | 5641 |
| 88 | Ga0466694_037316 | 3300042594 | Bacteria | 1098 |
| 89 | JGI24696J40584_12922671 | 3300002834 | Bacteria | 1367 |
| 90 | Ga0068305_10032869 | 3300005083 | Bacteria | 24471 |
| 91 | Ga0123355_10232056 | 3300009826 | Unclassified | 2633 |
| 92 | Ga0123356_10034966 | 3300010049 | Bacteria | 4696 |
| 93 | Ga0123353_10002040 | 3300010167 | Bacteria | 24948 |
| 94 | Ga0123353_10765635 | 3300010167 | Bacteria | 1340 |
| 95 | Ga0466702_280184 | 3300042635 | Bacteria | 2332 |
| 96 | Ga0466703_260503 | 3300042636 | Bacteria | 1430 |
| 97 | Ga0466724_39650 | 3300042649 | Bacteria | 1089 |
| 98 | Ga0466706_217298 | 3300042599 | Bacteria | 1387 |
| 99 | Ga0466700_009729 | 3300042600 | Bacteria | 1579 |
| 100 | Ga0466707_087373 | 3300042601 | Bacteria | 11377 |
| 101 | Ga0466713_064097 | 3300042602 | Bacteria | 36072 |
| 102 | Ga0466722_141564 | 3300042609 | Bacteria | 4713 |
| 103 | Ga0466696_312502 | 3300042596 | Bacteria | 1047 |
| 104 | Ga0466705_291477 | 3300042612 | Bacteria | 17050 |
| 105 | Ga0466715_277359 | 3300042616 | Bacteria | 2082 |
| 106 | Ga0466723_041296 | 3300042618 | Bacteria | 16340 |
| 107 | Ga0123356_10578557 | 3300010049 | Bacteria | 1286 |
| 108 | Ga0123353_10003223 | 3300010167 | Bacteria | 20554 |
| 109 | Ga0123353_10185740 | 3300010167 | Bacteria | 3287 |
| 110 | Ga0123353_10533043 | 3300010167 | Bacteria | 1699 |
| 111 | Ga0466729_265539 | 3300042621 | Bacteria | 2975 |
| 112 | Ga0466703_349787 | 3300042636 | Bacteria | 13319 |
| 113 | Ga0466708_023932 | 3300042652 | Bacteria | 8095 |
| 114 | Ga0466708_044368 | 3300042652 | Bacteria | 3481 |
| 115 | Ga0466700_295415 | 3300042600 | Bacteria | 1061 |
| 116 | Ga0466707_157350 | 3300042601 | Bacteria | 2131 |
| 117 | Ga0466707_214910 | 3300042601 | Bacteria | 5868 |
| 118 | Ga0466707_339854 | 3300042601 | Bacteria | 2091 |
| 119 | Ga0466716_162866 | 3300042605 | Bacteria | 1422 |
| 120 | Ga0466693_333416 | 3300042592 | Bacteria | 2401 |
| 121 | Ga0466711_288620 | 3300042615 | Unclassified | 2040 |
| 122 | Ga0466715_067556 | 3300042616 | Bacteria | 2467 |
| 123 | Ga0466723_052022 | 3300042618 | Bacteria | 10379 |
| 124 | Ga0466723_145579 | 3300042618 | Bacteria | 24568 |
| 125 | Ga0466728_044983 | 3300042620 | Bacteria | 17405 |
| 126 | Ga0123357_10663217 | 3300009784 | Unclassified | 766 |
| 127 | Ga0123355_10052080 | 3300009826 | Bacteria | 6643 |
| 128 | Ga0466704_339216 | 3300042643 | Bacteria | 4749 |
| 129 | Ga0466727_130526 | 3300042655 | Bacteria | 15106 |
| 130 | Ga0466719_032446 | 3300042606 | Bacteria | 2598 |
| 131 | Ga0466722_216127 | 3300042609 | Bacteria | 7707 |
| 132 | Ga0415639_014916 | 3300038395 | Bacteria | 13445 |
| 133 | Ga0466691_114417 | 3300042593 | Unclassified | 6387 |
| 134 | JGI24705J35276_11956761 | 3300002504 | Bacteria | 800 |
| 135 | JGI24700J35501_10929780 | 3300002508 | Unclassified | 10166 |
| 136 | Ga0466728_167970 | 3300042620 | Bacteria | 1459 |
| 137 | Ga0123357_10100897 | 3300009784 | Bacteria | 3722 |
| 138 | Ga0123357_10129410 | 3300009784 | Bacteria | 3150 |
| 139 | Ga0123355_10040555 | 3300009826 | Archaea | 7579 |
| 140 | Ga0123355_10462494 | 3300009826 | Bacteria | 1591 |
| 141 | Ga0123356_11163644 | 3300010049 | Bacteria | 938 |
| 142 | Ga0466703_130111 | 3300042636 | Bacteria | 1978 |
| 143 | Ga0466704_090215 | 3300042643 | Unclassified | 11253 |
| 144 | Ga0466707_021064 | 3300042601 | Bacteria | 1711 |
| 145 | Ga0466707_051885 | 3300042601 | Bacteria | 2884 |
| 146 | Ga0466707_085339 | 3300042601 | Bacteria | 9722 |
| 147 | Ga0466707_177673 | 3300042601 | Bacteria | 18718 |
| 148 | Ga0466714_016568 | 3300042603 | Bacteria | 1291 |
| 149 | Ga0466719_445809 | 3300042606 | Bacteria | 5388 |
| 150 | Ga0466692_014670 | 3300042591 | Bacteria | 29799 |
| 151 | Ga0466692_135158 | 3300042591 | Bacteria | 7312 |
| 152 | Ga0466696_473623 | 3300042596 | Bacteria | 1223 |
| 153 | Ga0068305_10019772 | 3300005083 | Bacteria | 6258 |
| 154 | Ga0123357_10000959 | 3300009784 | Bacteria | 29372 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01257 | 2Fe-2S_thioredx | Thioredoxin-like [2Fe-2S] ferredoxin | 40 | 184 | 0.96 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.