Protein Family IF08544
Metagenome
Isolate
152
Members
55
Samples
135
Scaffolds
446.98
Avg Length
Representative Sequence
- ID
- 3300042621|Ga0466729_220081|Ga0466729_220081_5928_7364
- Length
- 478 aa
- Sequence
- VSLKNYAYICGTIHKNYTLGLNIIYLYIKIYIMKRRDFLTSTALIGASMGIAPLGLASCSSKEKAKTLTPEELGMYSFVDIAPDGKPLKAALVGCGDRGTGAATQFLKAGPNVSIIALVDIFQDRMDSCRNVLKEKYNNEVPDANCFLGFDAYKKVLEMPDIDVVLLCTPTHFRPEQFRAAVEAGKHVFMEKPCAVDPTGIRTVIAAAKIATTKGLTVITGNQRRHSKAYWEAYVQVRNGAIGDIISGSAHWDQGAWWNKKKRPEWSDMEYCIRNWFNIKWLSGDHILDQAIHNIDVVTWFMGMRPINAAGFGGRARRLTGDIFDFFSVDYYYENNRKMLTTARQIDGCEGNVSEQVYGTKGMFTTKDGVHLEDYNGNIIWKYDYENQPEKNHYDQEHIHLVESIRLDKKINQAEDLAYSTLVAIQGREAAYTGKSVSWDEIMASDLRYGPETYALGPLPDYHEGQAPVPGKDPGAPM
Sample Types
Isolate
10.5%
Metagenome
89.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
27.3%
Termitidae
27.3%
Kalotermitidae
25.5%
Termopsidae
7.3%
Rhinotermitidae
5.5%
Unclassified
3.6%
Hodotermitidae
1.8%
Passalidae
1.8%
Taxonomy
Archaea
0
Bacteria
147
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 2 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 3 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 4 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 5 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 6 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 7 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 8 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 9 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 10 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 11 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 12 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 13 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 14 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 15 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 16 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 17 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 18 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 19 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 20 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 21 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 22 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 23 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 24 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 25 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 26 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 27 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 28 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 29 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 30 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 31 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 32 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 33 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 34 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 35 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 36 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 37 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 38 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 39 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 40 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 41 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 42 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 43 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 44 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 45 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 46 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 47 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 48 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 49 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 50 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 51 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 52 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 53 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 54 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 55 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_240337 | 3300042611 | Bacteria | 2379 |
| 2 | Ga0466694_270645 | 3300042594 | Bacteria | 4212 |
| 3 | Ga0123357_10012864 | 3300009784 | Bacteria | 10812 |
| 4 | Ga0123357_10080501 | 3300009784 | Bacteria | 4284 |
| 5 | Ga0466729_211175 | 3300042621 | Bacteria | 9657 |
| 6 | Ga0466729_220081 | 3300042621 | Bacteria | 7392 |
| 7 | Ga0466708_231274 | 3300042652 | Bacteria | 4319 |
| 8 | Ga0466727_027772 | 3300042655 | Bacteria | 2769 |
| 9 | Ga0466706_012025 | 3300042599 | Bacteria | 30310 |
| 10 | Ga0466707_192236 | 3300042601 | Bacteria | 7294 |
| 11 | Ga0466722_107993 | 3300042609 | Bacteria | 3326 |
| 12 | Ga0466722_111316 | 3300042609 | Bacteria | 9551 |
| 13 | Ga0466722_157163 | 3300042609 | Bacteria | 2985 |
| 14 | Ga0466710_178724 | 3300042613 | Unclassified | 3835 |
| 15 | Ga0466711_330054 | 3300042615 | Bacteria | 3565 |
| 16 | Ga0466723_196111 | 3300042618 | Bacteria | 3923 |
| 17 | Ga0466728_082257 | 3300042620 | Bacteria | 106309 |
| 18 | Ga0466705_140041 | 3300042612 | Bacteria | 12807 |
| 19 | Ga0466692_063390 | 3300042591 | Bacteria | 95171 |
| 20 | Ga0466696_443700 | 3300042596 | Bacteria | 8241 |
| 21 | Ga0466735_032708 | 3300042624 | Bacteria | 5895 |
| 22 | Ga0466704_078169 | 3300042643 | Bacteria | 9700 |
| 23 | Ga0466724_66342 | 3300042649 | Bacteria | 3404 |
| 24 | Ga0466707_154400 | 3300042601 | Bacteria | 4552 |
| 25 | Ga0466707_195411 | 3300042601 | Bacteria | 1391 |
| 26 | Ga0466714_065230 | 3300042603 | Bacteria | 2904 |
| 27 | Ga0466722_028231 | 3300042609 | Bacteria | 8437 |
| 28 | Ga0466722_233569 | 3300042609 | Bacteria | 2870 |
| 29 | Ga0466711_092050 | 3300042615 | Bacteria | 33984 |
| 30 | Ga0466715_568567 | 3300042616 | Bacteria | 17436 |
| 31 | Ga0466723_022002 | 3300042618 | Bacteria | 2614 |
| 32 | Ga0466726_436398 | 3300042619 | Bacteria | 10913 |
| 33 | Ga0466690_022508 | 3300042590 | Bacteria | 6990 |
| 34 | Ga0466690_071877 | 3300042590 | Bacteria | 20164 |
| 35 | Ga0466690_299302 | 3300042590 | Bacteria | 6785 |
| 36 | Ga0466692_011399 | 3300042591 | Bacteria | 2125 |
| 37 | Ga0466696_001915 | 3300042596 | Bacteria | 4752 |
| 38 | Ga0466696_123089 | 3300042596 | Bacteria | 9345 |
| 39 | Ga0123354_10000099 | 3300010882 | Bacteria | 64622 |
| 40 | Ga0466704_093764 | 3300042643 | Bacteria | 18620 |
| 41 | Ga0466709_221215 | 3300042648 | Bacteria | 16956 |
| 42 | Ga0466708_055652 | 3300042652 | Bacteria | 46153 |
| 43 | Ga0466725_075963 | 3300042654 | Bacteria | 10999 |
| 44 | Ga0466727_168576 | 3300042655 | Bacteria | 50187 |
| 45 | Ga0466727_334319 | 3300042655 | Unclassified | 2815 |
| 46 | Ga0466700_079445 | 3300042600 | Bacteria | 32199 |
| 47 | Ga0466714_087201 | 3300042603 | Bacteria | 3275 |
| 48 | Ga0466716_158904 | 3300042605 | Bacteria | 11394 |
| 49 | Ga0466715_098533 | 3300042616 | Bacteria | 22041 |
| 50 | Ga0466726_214269 | 3300042619 | Bacteria | 12075 |
| 51 | Ga0466728_101376 | 3300042620 | Bacteria | 11229 |
| 52 | Ga0466729_009735 | 3300042621 | Bacteria | 22167 |
| 53 | Ga0466692_000981 | 3300042591 | Bacteria | 14625 |
| 54 | Ga0123354_10013877 | 3300010882 | Bacteria | 12526 |
| 55 | Ga0123354_10051443 | 3300010882 | Bacteria | 6221 |
| 56 | JGI24702J35022_10000192 | 3300002462 | Bacteria | 32902 |
| 57 | Ga0068302_10432603 | 3300005071 | Bacteria | 2920 |
| 58 | Ga0466729_300952 | 3300042621 | Bacteria | 4663 |
| 59 | Ga0466704_187063 | 3300042643 | Bacteria | 10842 |
| 60 | Ga0466704_497222 | 3300042643 | Bacteria | 26011 |
| 61 | Ga0466709_415626 | 3300042648 | Bacteria | 10591 |
| 62 | Ga0466719_428416 | 3300042606 | Bacteria | 4206 |
| 63 | Ga0466722_015255 | 3300042609 | Bacteria | 47931 |
| 64 | Ga0466722_255236 | 3300042609 | Bacteria | 60597 |
| 65 | Ga0466710_141064 | 3300042613 | Bacteria | 7195 |
| 66 | Ga0466711_021246 | 3300042615 | Bacteria | 12591 |
| 67 | Ga0466726_039363 | 3300042619 | Unclassified | 5206 |
| 68 | Ga0466728_065619 | 3300042620 | Bacteria | 98744 |
| 69 | Ga0466697_089499 | 3300042611 | Bacteria | 34083 |
| 70 | Ga0466705_123086 | 3300042612 | Unclassified | 1411 |
| 71 | Ga0466657_014755 | 3300042582 | Bacteria | 7108 |
| 72 | Ga0123356_10114782 | 3300010049 | Bacteria | 2608 |
| 73 | Ga0123354_10106831 | 3300010882 | Bacteria | 3732 |
| 74 | JGI24705J35276_12230105 | 3300002504 | Bacteria | 3544 |
| 75 | Ga0123357_10000304 | 3300009784 | Bacteria | 46843 |
| 76 | Ga0466727_176346 | 3300042655 | Bacteria | 17609 |
| 77 | Ga0466707_025436 | 3300042601 | Bacteria | 2068 |
| 78 | Ga0466713_149587 | 3300042602 | Bacteria | 21967 |
| 79 | Ga0466716_167105 | 3300042605 | Bacteria | 9305 |
| 80 | Ga0466716_241110 | 3300042605 | Bacteria | 12441 |
| 81 | Ga0466716_283200 | 3300042605 | Bacteria | 4150 |
| 82 | Ga0466716_541825 | 3300042605 | Bacteria | 4446 |
| 83 | Ga0466722_056415 | 3300042609 | Bacteria | 9721 |
| 84 | Ga0466711_295610 | 3300042615 | Bacteria | 14335 |
| 85 | Ga0466715_324241 | 3300042616 | Bacteria | 9669 |
| 86 | Ga0466733_012433 | 3300042659 | Bacteria | 6020 |
| 87 | Ga0466657_194935 | 3300042582 | Bacteria | 4712 |
| 88 | Ga0466691_032657 | 3300042593 | Bacteria | 10386 |
| 89 | Ga0466735_161651 | 3300042624 | Bacteria | 1814 |
| 90 | Ga0466703_096833 | 3300042636 | Bacteria | 9387 |
| 91 | Ga0466703_117684 | 3300042636 | Bacteria | 9036 |
| 92 | Ga0466703_159636 | 3300042636 | Bacteria | 4430 |
| 93 | Ga0466703_356651 | 3300042636 | Bacteria | 10091 |
| 94 | Ga0466704_093311 | 3300042643 | Bacteria | 21533 |
| 95 | Ga0466704_131118 | 3300042643 | Bacteria | 4485 |
| 96 | Ga0466727_141604 | 3300042655 | Bacteria | 15570 |
| 97 | Ga0466713_143451 | 3300042602 | Bacteria | 3601 |
| 98 | Ga0466719_064990 | 3300042606 | Bacteria | 5999 |
| 99 | Ga0466715_171111 | 3300042616 | Bacteria | 30080 |
| 100 | Ga0466723_201512 | 3300042618 | Bacteria | 8547 |
| 101 | Ga0466692_045772 | 3300042591 | Bacteria | 23073 |
| 102 | Ga0466691_095546 | 3300042593 | Bacteria | 10378 |
| 103 | Ga0466696_180858 | 3300042596 | Bacteria | 1958 |
| 104 | Ga0123356_10013505 | 3300010049 | Bacteria | 7878 |
| 105 | IMNBL1DRAFT_c0001855 | 3300000062 | Bacteria | 15383 |
| 106 | Ga0068302_10018937 | 3300005071 | Bacteria | 4946 |
| 107 | Ga0466703_134508 | 3300042636 | Bacteria | 9884 |
| 108 | Ga0466708_302603 | 3300042652 | Bacteria | 21583 |
| 109 | Ga0466727_087033 | 3300042655 | Bacteria | 10438 |
| 110 | Ga0466701_048516 | 3300042598 | Bacteria | 12662 |
| 111 | Ga0466707_111695 | 3300042601 | Bacteria | 37145 |
| 112 | Ga0466713_084299 | 3300042602 | Bacteria | 4046 |
| 113 | Ga0466714_043113 | 3300042603 | Bacteria | 38005 |
| 114 | Ga0466716_509429 | 3300042605 | Bacteria | 19588 |
| 115 | Ga0466711_402421 | 3300042615 | Bacteria | 13902 |
| 116 | Ga0466715_212915 | 3300042616 | Bacteria | 24334 |
| 117 | Ga0466728_093166 | 3300042620 | Bacteria | 80427 |
| 118 | Ga0466728_399272 | 3300042620 | Bacteria | 209367 |
| 119 | Ga0466705_052595 | 3300042612 | Unclassified | 5291 |
| 120 | Ga0466690_005599 | 3300042590 | Bacteria | 9569 |
| 121 | Ga0466690_017210 | 3300042590 | Bacteria | 26050 |
| 122 | Ga0466690_319326 | 3300042590 | Bacteria | 13239 |
| 123 | Ga0466696_395311 | 3300042596 | Bacteria | 10238 |
| 124 | Ga0466703_025453 | 3300042636 | Bacteria | 3126 |
| 125 | Ga0466703_067070 | 3300042636 | Bacteria | 12812 |
| 126 | Ga0466703_107951 | 3300042636 | Bacteria | 23826 |
| 127 | Ga0466709_046697 | 3300042648 | Bacteria | 4384 |
| 128 | Ga0466727_093047 | 3300042655 | Bacteria | 16544 |
| 129 | Ga0466707_192130 | 3300042601 | Bacteria | 24568 |
| 130 | Ga0466707_408118 | 3300042601 | Bacteria | 11640 |
| 131 | Ga0466716_126384 | 3300042605 | Bacteria | 4442 |
| 132 | Ga0466716_547088 | 3300042605 | Bacteria | 12747 |
| 133 | Ga0466722_006350 | 3300042609 | Bacteria | 11807 |
| 134 | Ga0466722_080397 | 3300042609 | Bacteria | 11708 |
| 135 | Ga0466723_311502 | 3300042618 | Bacteria | 27850 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01408 | GO:0000166 | nucleotide binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.