Protein Family IF08524
Metagenome
Isolate
179
Members
62
Samples
163
Scaffolds
166.37
Avg Length
Representative Sequence
- ID
- 3300042621|Ga0466729_154498|Ga0466729_154498_929_1435
- Length
- 160 aa
- Sequence
- MKAMVSIIMGSTSDLPIMEKAAKVFDEFEIPFEMHALSAHRTPAEVEAFAKNAQARGIEVIIAAAGMAAHLPGVIASMTPLPVIGVPINASLDVQMPPGIPVATVGINGAMNAAILAAQILAVKDTDLQVKLVEYKENLKAKIVKANAELADVKYAFKTN
Sample Types
Isolate
8.9%
Metagenome
91.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
30.0%
Blattidae
26.7%
Kalotermitidae
21.7%
Termopsidae
6.7%
Rhinotermitidae
5.0%
Unclassified
5.0%
Passalidae
5.0%
Taxonomy
Archaea
0
Bacteria
173
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 2 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 3 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 4 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 5 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 6 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 7 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 8 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 9 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 10 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 11 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 12 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 13 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 14 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 15 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 16 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 17 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 18 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 19 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 20 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 21 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 22 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 23 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 24 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 25 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 26 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 27 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 28 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 29 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 30 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 31 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 32 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 33 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 34 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 35 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 36 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 37 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 38 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 39 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 40 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 41 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 42 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 43 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 44 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 45 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 46 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 47 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 48 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 49 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 50 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 51 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 52 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 53 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 54 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 55 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 56 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 57 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 58 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 59 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 60 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 61 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 62 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_173968 | 3300042612 | Bacteria | 9238 |
| 2 | Ga0466711_220493 | 3300042615 | Bacteria | 8885 |
| 3 | Ga0466715_376227 | 3300042616 | Bacteria | 52075 |
| 4 | Ga0466715_538212 | 3300042616 | Bacteria | 5401 |
| 5 | Ga0466723_059005 | 3300042618 | Bacteria | 62633 |
| 6 | Ga0466723_251372 | 3300042618 | Bacteria | 8326 |
| 7 | Ga0466690_130601 | 3300042590 | Bacteria | 9968 |
| 8 | Ga0466691_055967 | 3300042593 | Bacteria | 15249 |
| 9 | Ga0466696_039222 | 3300042596 | Bacteria | 17731 |
| 10 | Ga0466696_135131 | 3300042596 | Bacteria | 1533 |
| 11 | Ga0466696_281483 | 3300042596 | Bacteria | 4550 |
| 12 | Ga0466699_327669 | 3300042597 | Bacteria | 1244 |
| 13 | Ga0466707_065313 | 3300042601 | Bacteria | 19443 |
| 14 | Ga0466713_118128 | 3300042602 | Bacteria | 7447 |
| 15 | Ga0466714_017798 | 3300042603 | Bacteria | 1163 |
| 16 | Ga0466714_045336 | 3300042603 | Bacteria | 1344 |
| 17 | Ga0466716_177182 | 3300042605 | Bacteria | 2384 |
| 18 | Ga0466719_496020 | 3300042606 | Bacteria | 7373 |
| 19 | Ga0123357_10050576 | 3300009784 | Bacteria | 5625 |
| 20 | JGI24702J35022_10002926 | 3300002462 | Bacteria | 10336 |
| 21 | JGI24702J35022_10049765 | 3300002462 | Bacteria | 2232 |
| 22 | Ga0068302_10202762 | 3300005071 | Bacteria | 7390 |
| 23 | Ga0466703_303955 | 3300042636 | Bacteria | 5955 |
| 24 | Ga0466704_372245 | 3300042643 | Bacteria | 13926 |
| 25 | Ga0466704_416964 | 3300042643 | Bacteria | 11529 |
| 26 | Ga0466709_265168 | 3300042648 | Bacteria | 8445 |
| 27 | Ga0466705_050950 | 3300042612 | Bacteria | 13509 |
| 28 | Ga0466711_424279 | 3300042615 | Bacteria | 19107 |
| 29 | Ga0466723_025239 | 3300042618 | Bacteria | 67003 |
| 30 | Ga0466726_111774 | 3300042619 | Bacteria | 6340 |
| 31 | Ga0466690_009326 | 3300042590 | Bacteria | 10804 |
| 32 | Ga0466692_067935 | 3300042591 | Bacteria | 92005 |
| 33 | Ga0466691_027663 | 3300042593 | Bacteria | 17035 |
| 34 | Ga0466696_346905 | 3300042596 | Bacteria | 5494 |
| 35 | Ga0466707_308611 | 3300042601 | Bacteria | 7588 |
| 36 | Ga0466719_475599 | 3300042606 | Bacteria | 5361 |
| 37 | Ga0466722_159681 | 3300042609 | Bacteria | 66135 |
| 38 | Ga0466698_387585 | 3300042610 | Bacteria | 1770 |
| 39 | 2227038711 | 2225789003 | Bacteria | 4298 |
| 40 | Ga0466702_132736 | 3300042635 | Bacteria | 1383 |
| 41 | Ga0466703_188507 | 3300042636 | Bacteria | 1923 |
| 42 | Ga0466704_104269 | 3300042643 | Bacteria | 3321 |
| 43 | Ga0466727_094069 | 3300042655 | Bacteria | 10635 |
| 44 | Ga0466705_111062 | 3300042612 | Bacteria | 3120 |
| 45 | Ga0466733_094725 | 3300042659 | Bacteria | 1736 |
| 46 | Ga0466711_221983 | 3300042615 | Bacteria | 1789 |
| 47 | Ga0466711_242355 | 3300042615 | Bacteria | 12439 |
| 48 | Ga0466711_310276 | 3300042615 | Bacteria | 7852 |
| 49 | Ga0466715_130883 | 3300042616 | Bacteria | 15037 |
| 50 | Ga0466715_211123 | 3300042616 | Bacteria | 56208 |
| 51 | Ga0466723_176674 | 3300042618 | Bacteria | 1258 |
| 52 | Ga0466729_009851 | 3300042621 | Bacteria | 13606 |
| 53 | Ga0466690_018670 | 3300042590 | Bacteria | 64858 |
| 54 | Ga0466690_026402 | 3300042590 | Bacteria | 15626 |
| 55 | Ga0466690_252597 | 3300042590 | Bacteria | 23645 |
| 56 | Ga0466696_229623 | 3300042596 | Bacteria | 13286 |
| 57 | Ga0466701_013027 | 3300042598 | Bacteria | 25926 |
| 58 | Ga0466713_140716 | 3300042602 | Bacteria | 27446 |
| 59 | Ga0466722_171023 | 3300042609 | Bacteria | 1114 |
| 60 | IMNBL1DRAFT_c0016182 | 3300000062 | Bacteria | 3205 |
| 61 | JGI24702J35022_10009320 | 3300002462 | Bacteria | 5511 |
| 62 | JGI24702J35022_10142218 | 3300002462 | Bacteria | 1339 |
| 63 | JGI24702J35022_10198094 | 3300002462 | Bacteria | 1148 |
| 64 | Ga0068302_10017471 | 3300005071 | Bacteria | 10014 |
| 65 | Ga0466734_156464 | 3300042623 | Bacteria | 1086 |
| 66 | Ga0466735_101114 | 3300042624 | Unclassified | 1790 |
| 67 | Ga0466703_001188 | 3300042636 | Bacteria | 16315 |
| 68 | Ga0466704_298676 | 3300042643 | Unclassified | 9398 |
| 69 | Ga0466704_347428 | 3300042643 | Bacteria | 8993 |
| 70 | Ga0466704_347546 | 3300042643 | Bacteria | 9629 |
| 71 | Ga0466709_376955 | 3300042648 | Bacteria | 1817 |
| 72 | Ga0466727_074662 | 3300042655 | Bacteria | 12893 |
| 73 | Ga0466727_091831 | 3300042655 | Bacteria | 19270 |
| 74 | Ga0466705_020625 | 3300042612 | Bacteria | 6839 |
| 75 | Ga0466705_059065 | 3300042612 | Bacteria | 3436 |
| 76 | Ga0466705_238035 | 3300042612 | Bacteria | 7385 |
| 77 | Ga0466705_256313 | 3300042612 | Bacteria | 5041 |
| 78 | Ga0466705_273579 | 3300042612 | Bacteria | 7149 |
| 79 | Ga0466733_061651 | 3300042659 | Bacteria | 5014 |
| 80 | Ga0466710_108162 | 3300042613 | Bacteria | 1021 |
| 81 | Ga0466710_275422 | 3300042613 | Bacteria | 1748 |
| 82 | Ga0466715_280463 | 3300042616 | Bacteria | 6722 |
| 83 | Ga0466715_608206 | 3300042616 | Bacteria | 31747 |
| 84 | Ga0466718_115831 | 3300042617 | Unclassified | 3450 |
| 85 | Ga0466723_199992 | 3300042618 | Bacteria | 37648 |
| 86 | Ga0466691_108296 | 3300042593 | Bacteria | 56200 |
| 87 | Ga0072941_1332165 | 3300005201 | Bacteria | 1332 |
| 88 | Ga0466735_213730 | 3300042624 | Bacteria | 5249 |
| 89 | Ga0466703_402029 | 3300042636 | Bacteria | 8278 |
| 90 | Ga0466709_260373 | 3300042648 | Bacteria | 3715 |
| 91 | Ga0466727_041042 | 3300042655 | Bacteria | 9323 |
| 92 | Ga0466711_156618 | 3300042615 | Bacteria | 3366 |
| 93 | Ga0466715_117780 | 3300042616 | Bacteria | 16481 |
| 94 | Ga0466726_049576 | 3300042619 | Bacteria | 4489 |
| 95 | Ga0466729_138007 | 3300042621 | Bacteria | 2253 |
| 96 | Ga0466693_304236 | 3300042592 | Unclassified | 1408 |
| 97 | Ga0466696_256297 | 3300042596 | Bacteria | 1666 |
| 98 | Ga0466696_391983 | 3300042596 | Bacteria | 3095 |
| 99 | Ga0466707_396626 | 3300042601 | Bacteria | 7136 |
| 100 | Ga0466713_029733 | 3300042602 | Bacteria | 5628 |
| 101 | Ga0123356_10043170 | 3300010049 | Bacteria | 4198 |
| 102 | JGI24702J35022_10101258 | 3300002462 | Bacteria | 1577 |
| 103 | Ga0068305_10044632 | 3300005083 | Bacteria | 1875 |
| 104 | Ga0466735_034971 | 3300042624 | Bacteria | 4166 |
| 105 | Ga0466703_195103 | 3300042636 | Bacteria | 3170 |
| 106 | Ga0466704_077861 | 3300042643 | Bacteria | 29104 |
| 107 | Ga0466704_264183 | 3300042643 | Bacteria | 11866 |
| 108 | Ga0466697_203974 | 3300042611 | Bacteria | 1496 |
| 109 | Ga0466711_009001 | 3300042615 | Bacteria | 22653 |
| 110 | Ga0466729_154498 | 3300042621 | Bacteria | 4048 |
| 111 | Ga0466693_068224 | 3300042592 | Bacteria | 1333 |
| 112 | Ga0466696_014961 | 3300042596 | Bacteria | 77550 |
| 113 | Ga0466696_177482 | 3300042596 | Bacteria | 10285 |
| 114 | Ga0466707_368698 | 3300042601 | Bacteria | 2249 |
| 115 | Ga0466713_066012 | 3300042602 | Bacteria | 3740 |
| 116 | Ga0466716_065216 | 3300042605 | Bacteria | 17320 |
| 117 | Ga0466716_185862 | 3300042605 | Bacteria | 10030 |
| 118 | Ga0466722_160383 | 3300042609 | Bacteria | 27402 |
| 119 | 2227108597 | 2225789004 | Bacteria | 9475 |
| 120 | 2227303000 | 2225789004 | Bacteria | 29649 |
| 121 | JGI24702J35022_10051114 | 3300002462 | Bacteria | 2203 |
| 122 | JGI24699J35502_11016682 | 3300002509 | Bacteria | 1428 |
| 123 | Ga0466729_294315 | 3300042621 | Bacteria | 2062 |
| 124 | Ga0466729_299014 | 3300042621 | Unclassified | 1157 |
| 125 | Ga0466735_091666 | 3300042624 | Bacteria | 4215 |
| 126 | Ga0466735_203587 | 3300042624 | Bacteria | 2751 |
| 127 | Ga0466735_212233 | 3300042624 | Bacteria | 1710 |
| 128 | Ga0466703_192377 | 3300042636 | Bacteria | 11854 |
| 129 | Ga0466704_099577 | 3300042643 | Bacteria | 9180 |
| 130 | Ga0466705_246247 | 3300042612 | Bacteria | 13962 |
| 131 | Ga0466705_346414 | 3300042612 | Bacteria | 5714 |
| 132 | Ga0466733_179319 | 3300042659 | Bacteria | 39888 |
| 133 | Ga0466711_231558 | 3300042615 | Bacteria | 14810 |
| 134 | Ga0466711_433577 | 3300042615 | Bacteria | 4133 |
| 135 | Ga0466690_042308 | 3300042590 | Bacteria | 10596 |
| 136 | Ga0466690_073807 | 3300042590 | Bacteria | 6196 |
| 137 | Ga0466691_096844 | 3300042593 | Bacteria | 17647 |
| 138 | Ga0466696_181340 | 3300042596 | Bacteria | 1549 |
| 139 | Ga0466720_040942 | 3300042607 | Bacteria | 1533 |
| 140 | 2227550478 | 2225789004 | Bacteria | 2857 |
| 141 | Ga0068305_10001818 | 3300005083 | Bacteria | 2635 |
| 142 | Ga0068305_10041193 | 3300005083 | Bacteria | 4854 |
| 143 | Ga0466703_121300 | 3300042636 | Bacteria | 23338 |
| 144 | Ga0466703_197310 | 3300042636 | Bacteria | 1355 |
| 145 | Ga0466704_020905 | 3300042643 | Bacteria | 8748 |
| 146 | Ga0466704_603857 | 3300042643 | Bacteria | 6421 |
| 147 | Ga0466727_285270 | 3300042655 | Bacteria | 2333 |
| 148 | Ga0466705_300863 | 3300042612 | Bacteria | 4767 |
| 149 | Ga0466728_166110 | 3300042620 | Bacteria | 6055 |
| 150 | Ga0466728_278597 | 3300042620 | Bacteria | 2661 |
| 151 | Ga0265387_1007702 | 3300024582 | Bacteria | 1447 |
| 152 | Ga0466692_183726 | 3300042591 | Bacteria | 3527 |
| 153 | Ga0466707_214848 | 3300042601 | Bacteria | 1585 |
| 154 | Ga0466713_127493 | 3300042602 | Bacteria | 2671 |
| 155 | Ga0466713_137742 | 3300042602 | Bacteria | 54116 |
| 156 | Ga0466716_104532 | 3300042605 | Bacteria | 5986 |
| 157 | Ga0466716_230694 | 3300042605 | Bacteria | 14957 |
| 158 | Ga0466719_206285 | 3300042606 | Bacteria | 2482 |
| 159 | Ga0123354_10000501 | 3300010882 | Bacteria | 39365 |
| 160 | 2226988711 | 2225789003 | Unclassified | 7584 |
| 161 | JGI24696J40584_12934218 | 3300002834 | Bacteria | 1535 |
| 162 | Ga0466735_122610 | 3300042624 | Bacteria | 2171 |
| 163 | Ga0466727_325777 | 3300042655 | Bacteria | 11757 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00731 | AIRC | AIR carboxylase | 5 | 141 | 0.97 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00731 | GO:0006189 | 'de novo' IMP biosynthetic process | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.