Protein Family IF08503

Metagenome Isolate
140 Members
83 Samples
95 Scaffolds
390.09 Avg Length

🧬 Representative Sequence

ID
3300042621|Ga0466729_112099|Ga0466729_112099_16192_17367
Length
383 aa
Sequence
MYLCEQTWRWYGPNDPVSLCDIRQAGATGVVTALHHIPNGVAWSKEEIQKRINLVESAGLRWSVVESVPVHEHIKTHTGNFLQYIENYKESIRNLGACGIKVLTYNFMPVLDWTRTDLAYTLPDGSKALRFERAAFMAFDLYILKRPAAETEYAERFDEMSEADKHLLTRNMIAGLPGSEESFTIEQFRHELERYKDIDAEKLRSNLIFFLREIAPVADEAGVRLVIHPDDPPYPILGLPRILSTENDFQALIDAVPNQSNGLCLCTGSFGVRADNDLAGMMERYGDRIDFVHLRSTQRDEEGNFYEANHLEGNVDMYGVMKALLELQQRRGCSIAMRPDHGHQMIDDLKKKTNPGYSCIGRLRGLAELRGLEMGIVKSIINE

📊 Sample Types

Isolate 32.1%
Metagenome 67.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 37.3%
Kalotermitidae 16.9%
Termitidae 10.8%
Unclassified 9.6%
Rhinotermitidae 7.2%
Passalidae 3.6%
Termopsidae 3.6%
Hydrophilidae 2.4%
Elmidae 2.4%
Hodotermitidae 1.2%
Apidae 1.2%
Culicidae 1.2%
Formicidae 1.2%
Armadillidiidae 1.2%

🌳 Taxonomy

Archaea 0
Bacteria 137
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
2 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
3 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
4 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
5 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
6 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
7 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
8 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
9 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
10 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
11 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
12 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
13 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
14 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
15 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
16 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
17 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
18 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
19 2923982719 Parabacteroides sp. 52 Isolate Blattidae
20 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
21 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
22 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
23 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
24 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
25 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
26 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
27 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
28 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
29 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
30 3004672520 Bacteroides sp. 51 Isolate Blattidae
31 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
32 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
33 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
34 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
35 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
36 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
37 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
38 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
39 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
40 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
41 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
42 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
43 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
44 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
45 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
46 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
47 8065497608 Tellurirhabdus bombi IE-0392 Isolate Apidae
48 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
49 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
50 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
51 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
52 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
53 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
54 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
55 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
56 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
57 2718217924 Pseudonocardia sp. HH130630-07 Isolate Formicidae
58 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
59 2922326829 Bacteroides sp. 224 Isolate Blattidae
60 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
61 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
62 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
63 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
64 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
65 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
66 3004667792 Bacteroides sp. 519 Isolate Blattidae
67 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
68 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
69 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
70 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
71 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
72 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
73 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
74 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
75 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
76 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
77 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
78 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
79 2864878056 Flavobacterium notoginsengisoli S00128 Isolate Elmidae
80 2864886855 Flavobacterium nitrogenifigens S00142 Isolate Elmidae
81 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
82 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
83 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466726_238359 3300042619 Bacteria 5831
2 Ga0466707_383864 3300042601 Bacteria 6861
3 Ga0123354_10060408 3300010882 Bacteria 5608
4 IMNBL1DRAFT_c0003068 3300000062 Bacteria 11029
5 Ga0466729_272043 3300042621 Bacteria 3232
6 Ga0466735_118349 3300042624 Bacteria 3834
7 Ga0466703_007602 3300042636 Bacteria 8500
8 Ga0466704_191027 3300042643 Bacteria 94994
9 Ga0466708_367530 3300042652 Bacteria 33206
10 Ga0466727_081347 3300042655 Bacteria 65648
11 Ga0466733_106990 3300042659 Bacteria 5723
12 Ga0466715_468542 3300042616 Bacteria 12107
13 Ga0466715_580374 3300042616 Bacteria 5200
14 Ga0466715_621995 3300042616 Bacteria 20259
15 Ga0466723_332822 3300042618 Bacteria 1359
16 Ga0466707_270689 3300042601 Bacteria 5663
17 Ga0466719_567314 3300042606 Bacteria 4255
18 2227671835 2225789004 Bacteria 10136
19 IMNBL1DRAFT_c0001477 3300000062 Bacteria 17564
20 Ga0466703_155535 3300042636 Bacteria 15135
21 Ga0466704_040843 3300042643 Bacteria 12472
22 Ga0466705_014678 3300042612 Bacteria 3988
23 Ga0466705_236024 3300042612 Bacteria 10832
24 Ga0466732_024843 3300042656 Unclassified 1348
25 Ga0466733_051945 3300042659 Bacteria 7849
26 Ga0466733_158305 3300042659 Unclassified 2723
27 Ga0466711_295458 3300042615 Bacteria 2298
28 Ga0466706_268510 3300042599 Bacteria 14987
29 Ga0466713_020921 3300042602 Bacteria 109196
30 Ga0123354_10000013 3300010882 Bacteria 155838
31 IMNBL1DRAFT_c0001033 3300000062 Bacteria 21555
32 Ga0068305_10029960 3300005083 Bacteria 32183
33 Ga0160457_1000005 3300012858 Bacteria 622134
34 Ga0466735_075614 3300042624 Bacteria 16269
35 Ga0466704_115477 3300042643 Bacteria 5925
36 Ga0466708_020567 3300042652 Bacteria 16277
37 Ga0466705_192618 3300042612 Bacteria 21414
38 Ga0466710_412082 3300042613 Bacteria 5635
39 Ga0466728_446704 3300042620 Bacteria 5248
40 Ga0466706_173354 3300042599 Bacteria 2238
41 Ga0466700_221114 3300042600 Bacteria 50828
42 Ga0466707_274399 3300042601 Bacteria 2686
43 Ga0123353_10109370 3300010167 Bacteria 4453
44 Ga0123354_10177103 3300010882 Bacteria 2452
45 2227008131 2225789003 Bacteria 28853
46 Ga0466691_146559 3300042593 Bacteria 21127
47 Ga0466696_416178 3300042596 Bacteria 4286
48 Ga0466703_211551 3300042636 Bacteria 10631
49 Ga0466704_075969 3300042643 Bacteria 12341
50 Ga0466704_303542 3300042643 Bacteria 5711
51 Ga0466712_108853 3300042614 Bacteria 2901
52 Ga0466715_256229 3300042616 Bacteria 16623
53 Ga0466715_592687 3300042616 Bacteria 16089
54 Ga0466723_114888 3300042618 Bacteria 8393
55 Ga0466706_186023 3300042599 Bacteria 49026
56 Ga0466713_102313 3300042602 Bacteria 97036
57 Ga0466713_131061 3300042602 Bacteria 40781
58 Ga0466722_141672 3300042609 Bacteria 12678
59 Ga0123354_10208585 3300010882 Bacteria 2120
60 Ga0160460_100018 3300012845 Bacteria 384310
61 Ga0466692_060077 3300042591 Bacteria 30360
62 Ga0466691_029086 3300042593 Bacteria 16177
63 Ga0466702_032531 3300042635 Bacteria 1449
64 Ga0466708_020098 3300042652 Unclassified 3183
65 Ga0466708_128147 3300042652 Bacteria 3445
66 Ga0466727_239904 3300042655 Bacteria 5255
67 Ga0466733_015572 3300042659 Bacteria 8017
68 Ga0466733_021293 3300042659 Bacteria 16993
69 Ga0466733_099852 3300042659 Bacteria 3128
70 Ga0466705_434366 3300042612 Bacteria 8564
71 Ga0466728_260864 3300042620 Bacteria 23871
72 Ga0466706_252393 3300042599 Bacteria 20742
73 Ga0466713_005635 3300042602 Bacteria 57913
74 Ga0466690_391289 3300042590 Bacteria 25345
75 Ga0466696_105777 3300042596 Bacteria 41166
76 Ga0466708_074788 3300042652 Bacteria 9645
77 Ga0466708_330615 3300042652 Bacteria 4018
78 Ga0466727_326175 3300042655 Bacteria 3297
79 Ga0466705_019354 3300042612 Bacteria 6601
80 Ga0466711_273705 3300042615 Bacteria 6835
81 Ga0466715_011112 3300042616 Bacteria 16804
82 Ga0466715_195525 3300042616 Bacteria 4268
83 Ga0466728_311604 3300042620 Bacteria 10551
84 Ga0466729_122540 3300042621 Bacteria 3502
85 Ga0466716_379845 3300042605 Bacteria 3799
86 2227535727 2225789004 Bacteria 57737
87 IMNBL1DRAFT_c0001954 3300000062 Bacteria 14850
88 Ga0466703_092323 3300042636 Bacteria 10874
89 Ga0466733_065312 3300042659 Bacteria 101833
90 Ga0466711_135365 3300042615 Bacteria 14177
91 Ga0466711_225552 3300042615 Bacteria 18887
92 Ga0466729_112099 3300042621 Bacteria 18792
93 Ga0466695_027528 3300042595 Bacteria 2513
94 Ga0466709_065036 3300042648 Bacteria 14993
95 Ga0466709_169723 3300042648 Bacteria 216757

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03786 UxuA D-mannonate dehydratase (UxuA) 5 376 0.98
PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel 196 328 0.78

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.