Protein Family IF08469
Metagenome
Isolate
232
Members
159
Samples
125
Scaffolds
197.54
Avg Length
Representative Sequence
- ID
- 3300042620|Ga0466728_439213|Ga0466728_439213_1984_2595
- Length
- 197 aa
- Sequence
- MDLVSRVKEHFTDSAQAKLDAIEALAAPLAGAVLVGNGKILACGNGGSAADAQHFAAELVGRFEMERQSLAAIALTTDSSILTAVSNDYGYNTVFERQVRALGQSGDLLLAISTSGNSPSIVEAVRAAHENDLRVVALTGKGGGEIGRILHETDVHLCVPSERTARIQEIHLLAIHCLCDGIDCLLLGVDEDFNPRP
Sample Types
Isolate
46.1%
Metagenome
53.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
51.0%
Unclassified
14.6%
Termitidae
12.1%
Kalotermitidae
8.9%
Termopsidae
2.5%
Culicidae
2.5%
Rhinotermitidae
1.9%
Largidae
1.3%
Passalidae
1.3%
Berytidae
1.3%
Alydidae
1.3%
Elmidae
0.6%
Hodotermitidae
0.6%
Taxonomy
Archaea
0
Bacteria
228
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820065746 | Unclassified Proteobacteria Nt197P3bin56 | Isolate | Unclassified |
| 2 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 3 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 4 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 5 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 6 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 7 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 8 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 9 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 10 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 11 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 12 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 13 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 14 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 15 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 16 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 17 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 18 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 19 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 20 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 21 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 22 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 23 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 24 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 25 | 2820047982 | Unclassified Proteobacteria Th196P3bin67 | Isolate | Unclassified |
| 26 | 2820131053 | Unclassified Proteobacteria Emb289P3bin8 | Isolate | Unclassified |
| 27 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 28 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 29 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 30 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 31 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 32 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 33 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 34 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 35 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 36 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 37 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 38 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 39 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 40 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 41 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 42 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 43 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 44 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 45 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 46 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 47 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 48 | 2820042117 | Unclassified Proteobacteria Th196P4bin58 | Isolate | Unclassified |
| 49 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 50 | 2820086750 | Unclassified Proteobacteria Lab288P3bin98 | Isolate | Unclassified |
| 51 | 2820161938 | Unclassified Proteobacteria Cu122P3bin14 | Isolate | Unclassified |
| 52 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 53 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 54 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 55 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 56 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 57 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 58 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 59 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 60 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 61 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 62 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 63 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 64 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 65 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 66 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 67 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 68 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 69 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 70 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 71 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 72 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 73 | 2820103659 | Unclassified Proteobacteria Emb289P4bin67 | Isolate | Unclassified |
| 74 | 2820121232 | Unclassified Proteobacteria Emb289P4bin32 | Isolate | Unclassified |
| 75 | 2820123897 | Unclassified Proteobacteria Emb289P4bin18 | Isolate | Unclassified |
| 76 | 2820164216 | Unclassified Proteobacteria Cu122P1bin22 | Isolate | Unclassified |
| 77 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 78 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 79 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 80 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 81 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 82 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 83 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 84 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 85 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 86 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 87 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 88 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 89 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 90 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 91 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 92 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 93 | 2902438364 | Photobacterium damselae Hep-2a-11 | Isolate | Unclassified |
| 94 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 95 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 96 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 97 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 98 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 99 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 100 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 101 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 102 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 103 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 104 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 105 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 106 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 107 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 108 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 109 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 110 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 111 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 112 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 113 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 114 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 115 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 116 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 117 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 118 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 119 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 120 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 121 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 122 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 123 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 124 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 125 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 126 | 2820089333 | Unclassified Proteobacteria Lab288P3bin88 | Isolate | Unclassified |
| 127 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 128 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 129 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 130 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 131 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 132 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 133 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 134 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 135 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 136 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 137 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 138 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 139 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 140 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 141 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 142 | 2820062699 | Unclassified Proteobacteria Nt197P4bin15 | Isolate | Unclassified |
| 143 | 2820071837 | Unclassified Proteobacteria Nt197P3bin132 | Isolate | Unclassified |
| 144 | 2820077244 | Unclassified Proteobacteria Lab288P4bin72 | Isolate | Unclassified |
| 145 | 2820152154 | Unclassified Proteobacteria Cu122P5bin47 | Isolate | Unclassified |
| 146 | 2834230000 | Pandoraea novymonadis E262 | Isolate | Unclassified |
| 147 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 148 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 149 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 150 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 151 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 152 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 153 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 154 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 155 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 156 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 157 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 158 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 159 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466703_410483 | 3300042636 | Bacteria | 2756 |
| 2 | Ga0466704_364982 | 3300042643 | Bacteria | 1193 |
| 3 | Ga0466704_365791 | 3300042643 | Bacteria | 15584 |
| 4 | Ga0466709_122935 | 3300042648 | Bacteria | 3456 |
| 5 | Ga0466708_089535 | 3300042652 | Bacteria | 39014 |
| 6 | Ga0466710_269091 | 3300042613 | Bacteria | 2954 |
| 7 | Ga0466723_297880 | 3300042618 | Bacteria | 18013 |
| 8 | Ga0466728_245405 | 3300042620 | Bacteria | 43108 |
| 9 | Ga0466729_164561 | 3300042621 | Bacteria | 16474 |
| 10 | Ga0466692_203227 | 3300042591 | Bacteria | 20809 |
| 11 | Ga0466696_012277 | 3300042596 | Bacteria | 3141 |
| 12 | Ga0072941_1174777 | 3300005201 | Bacteria | 3378 |
| 13 | Ga0466697_217805 | 3300042611 | Bacteria | 1850 |
| 14 | Ga0123356_10091628 | 3300010049 | Bacteria | 2897 |
| 15 | Ga0466729_257840 | 3300042621 | Bacteria | 1537 |
| 16 | Ga0466734_119797 | 3300042623 | Bacteria | 5889 |
| 17 | Ga0466703_116211 | 3300042636 | Bacteria | 1947 |
| 18 | Ga0466703_381869 | 3300042636 | Bacteria | 1123 |
| 19 | Ga0466709_117189 | 3300042648 | Unclassified | 15262 |
| 20 | Ga0466725_366912 | 3300042654 | Bacteria | 1121 |
| 21 | Ga0466706_285858 | 3300042599 | Bacteria | 4562 |
| 22 | Ga0466713_060734 | 3300042602 | Bacteria | 1599 |
| 23 | Ga0466717_023338 | 3300042604 | Bacteria | 17981 |
| 24 | Ga0466719_069986 | 3300042606 | Bacteria | 8077 |
| 25 | Ga0466719_132785 | 3300042606 | Bacteria | 6799 |
| 26 | Ga0466719_572312 | 3300042606 | Bacteria | 1383 |
| 27 | Ga0466657_272543 | 3300042582 | Bacteria | 144653 |
| 28 | Ga0466692_185911 | 3300042591 | Bacteria | 4718 |
| 29 | Ga0466701_006218 | 3300042598 | Bacteria | 17378 |
| 30 | JGI24702J35022_10020571 | 3300002462 | Bacteria | 3582 |
| 31 | Ga0068305_10109717 | 3300005083 | Bacteria | 1205 |
| 32 | Ga0466705_245013 | 3300042612 | Bacteria | 2871 |
| 33 | Ga0123357_10463518 | 3300009784 | Unclassified | 1087 |
| 34 | Ga0123353_10036682 | 3300010167 | Bacteria | 7681 |
| 35 | Ga0123354_10000011 | 3300010882 | Bacteria | 166906 |
| 36 | Ga0466729_307343 | 3300042621 | Bacteria | 23331 |
| 37 | Ga0466704_036106 | 3300042643 | Bacteria | 32069 |
| 38 | Ga0466725_061251 | 3300042654 | Bacteria | 41948 |
| 39 | Ga0466727_299450 | 3300042655 | Bacteria | 2152 |
| 40 | Ga0466707_068680 | 3300042601 | Bacteria | 48211 |
| 41 | Ga0466707_076981 | 3300042601 | Bacteria | 18415 |
| 42 | Ga0466722_028901 | 3300042609 | Bacteria | 4899 |
| 43 | Ga0466726_328802 | 3300042619 | Bacteria | 2605 |
| 44 | Ga0160470_105676 | 3300012813 | Bacteria | 1545 |
| 45 | Ga0160459_100126 | 3300012831 | Bacteria | 56897 |
| 46 | Ga0466657_065378 | 3300042582 | Bacteria | 32493 |
| 47 | Ga0466657_374045 | 3300042582 | Bacteria | 2439 |
| 48 | Ga0466691_041725 | 3300042593 | Bacteria | 7993 |
| 49 | Ga0466696_407196 | 3300042596 | Bacteria | 1860 |
| 50 | Ga0466696_499699 | 3300042596 | Bacteria | 2081 |
| 51 | JGI24702J35022_10032759 | 3300002462 | Bacteria | 2781 |
| 52 | Ga0466705_159134 | 3300042612 | Bacteria | 9003 |
| 53 | Ga0466733_096607 | 3300042659 | Bacteria | 89302 |
| 54 | Ga0123353_10001758 | 3300010167 | Bacteria | 26573 |
| 55 | Ga0123354_10000381 | 3300010882 | Bacteria | 42382 |
| 56 | Ga0160471_102261 | 3300012812 | Unclassified | 3272 |
| 57 | Ga0466735_146043 | 3300042624 | Bacteria | 2973 |
| 58 | Ga0466704_103441 | 3300042643 | Bacteria | 2415 |
| 59 | Ga0466709_012927 | 3300042648 | Bacteria | 10506 |
| 60 | Ga0466708_264046 | 3300042652 | Bacteria | 12200 |
| 61 | Ga0466725_167906 | 3300042654 | Bacteria | 22951 |
| 62 | Ga0466701_017468 | 3300042598 | Bacteria | 1377 |
| 63 | Ga0466700_081669 | 3300042600 | Bacteria | 2991 |
| 64 | Ga0466719_420004 | 3300042606 | Bacteria | 4420 |
| 65 | Ga0466722_077751 | 3300042609 | Bacteria | 7114 |
| 66 | Ga0466710_138157 | 3300042613 | Bacteria | 41080 |
| 67 | Ga0466718_038676 | 3300042617 | Bacteria | 4875 |
| 68 | Ga0466729_027393 | 3300042621 | Bacteria | 15058 |
| 69 | Ga0160460_101692 | 3300012845 | Bacteria | 6624 |
| 70 | Ga0466692_112435 | 3300042591 | Bacteria | 72698 |
| 71 | Ga0466691_098359 | 3300042593 | Bacteria | 5204 |
| 72 | IMNBGM34_c000079 | 3300000036 | Bacteria | 27308 |
| 73 | Ga0068302_10001559 | 3300005071 | Bacteria | 6134 |
| 74 | Ga0068305_10700971 | 3300005083 | Bacteria | 1305 |
| 75 | Ga0123357_10000184 | 3300009784 | Bacteria | 57885 |
| 76 | Ga0123356_10309565 | 3300010049 | Bacteria | 1688 |
| 77 | Ga0466735_113132 | 3300042624 | Bacteria | 5497 |
| 78 | Ga0466708_004235 | 3300042652 | Bacteria | 7083 |
| 79 | Ga0466701_101286 | 3300042598 | Bacteria | 2589 |
| 80 | Ga0466707_046958 | 3300042601 | Bacteria | 18671 |
| 81 | Ga0466717_214772 | 3300042604 | Bacteria | 6102 |
| 82 | Ga0466715_123783 | 3300042616 | Bacteria | 10148 |
| 83 | Ga0466728_439213 | 3300042620 | Bacteria | 4021 |
| 84 | Ga0415639_174196 | 3300038395 | Bacteria | 1960 |
| 85 | JGI24705J35276_12236636 | 3300002504 | Bacteria | 8501 |
| 86 | Ga0466705_149511 | 3300042612 | Bacteria | 3933 |
| 87 | Ga0123356_10037581 | 3300010049 | Bacteria | 4515 |
| 88 | Ga0123353_11179248 | 3300010167 | Bacteria | 1007 |
| 89 | Ga0466704_468607 | 3300042643 | Bacteria | 3278 |
| 90 | Ga0466725_193092 | 3300042654 | Bacteria | 188399 |
| 91 | Ga0466706_049160 | 3300042599 | Bacteria | 3640 |
| 92 | Ga0466713_023749 | 3300042602 | Bacteria | 9955 |
| 93 | Ga0466716_442801 | 3300042605 | Bacteria | 1481 |
| 94 | Ga0466722_077673 | 3300042609 | Bacteria | 46854 |
| 95 | Ga0466722_112557 | 3300042609 | Unclassified | 2359 |
| 96 | Ga0466712_004758 | 3300042614 | Bacteria | 8319 |
| 97 | Ga0160459_100086 | 3300012831 | Bacteria | 103432 |
| 98 | Ga0466657_011395 | 3300042582 | Bacteria | 32120 |
| 99 | Ga0466696_284474 | 3300042596 | Bacteria | 5124 |
| 100 | Ga0466734_062941 | 3300042623 | Bacteria | 2107 |
| 101 | Ga0466704_313824 | 3300042643 | Bacteria | 1492 |
| 102 | Ga0466725_037252 | 3300042654 | Bacteria | 45444 |
| 103 | Ga0466707_176451 | 3300042601 | Bacteria | 6330 |
| 104 | Ga0466719_389758 | 3300042606 | Bacteria | 2220 |
| 105 | Ga0466710_015383 | 3300042613 | Bacteria | 36186 |
| 106 | Ga0466710_100458 | 3300042613 | Bacteria | 42158 |
| 107 | Ga0466715_416314 | 3300042616 | Bacteria | 6626 |
| 108 | Ga0466726_040345 | 3300042619 | Bacteria | 10659 |
| 109 | Ga0466726_106064 | 3300042619 | Bacteria | 1627 |
| 110 | Ga0466729_082919 | 3300042621 | Bacteria | 3042 |
| 111 | Ga0466657_244005 | 3300042582 | Bacteria | 6549 |
| 112 | Ga0466692_067671 | 3300042591 | Bacteria | 14927 |
| 113 | Ga0466701_009820 | 3300042598 | Bacteria | 5815 |
| 114 | Ga0072941_1070805 | 3300005201 | Bacteria | 2492 |
| 115 | Ga0466705_330694 | 3300042612 | Bacteria | 1578 |
| 116 | Ga0123357_10025066 | 3300009784 | Bacteria | 8040 |
| 117 | Ga0466730_051134 | 3300042625 | Bacteria | 3166 |
| 118 | Ga0466703_361449 | 3300042636 | Bacteria | 4327 |
| 119 | Ga0466717_019791 | 3300042604 | Bacteria | 5856 |
| 120 | Ga0466711_106607 | 3300042615 | Bacteria | 4761 |
| 121 | Ga0466715_462587 | 3300042616 | Bacteria | 8104 |
| 122 | Ga0160440_100042 | 3300012815 | Bacteria | 180722 |
| 123 | Ga0466657_309882 | 3300042582 | Bacteria | 36042 |
| 124 | Ga0466690_374945 | 3300042590 | Bacteria | 57693 |
| 125 | IMNBL1DRAFT_c0001097 | 3300000062 | Bacteria | 20759 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.