Protein Family IF08443
Metagenome
Isolate
129
Members
35
Samples
126
Scaffolds
249.85
Avg Length
Representative Sequence
- ID
- 3300042620|Ga0466728_255978|Ga0466728_255978_4931_5827
- Length
- 298 aa
- Sequence
- MKEAEAYRKRKRPEKRSGVKIYYFSGTGNTLWSAKKIAGYLDQSQNPAGFEESFEGNSDPAAAKPVRAELCSIGKLMRQAPAPIEADRVVFMFPSYAYQMPLLVRRFIIRSEIRSPYIAALVTYGSDPGGTLAELYRILKRKNLSLSFSGRIPSVENYIPIFGPPGEETKRKRLLLQDHATEEAARAIRAGKTNSPWRIRPLSVFVSSLFRLGLKKNVFVKGFKLNAACNGCGLCGRICPGNAIVMEKGKPVFTEGCEQCQACLNWCPRRSISFLRFRGDTEPYHHPGVRVEEMLAGP
Sample Types
Isolate
2.3%
Metagenome
97.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
38.2%
Termitidae
32.4%
Unclassified
11.8%
Rhinotermitidae
8.8%
Termopsidae
5.9%
Hodotermitidae
2.9%
Taxonomy
Archaea
0
Bacteria
112
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 2 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 3 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 4 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 5 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 6 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 7 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 8 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 9 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 10 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 11 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 12 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 13 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 14 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 15 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 16 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 17 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 18 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 19 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 20 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 21 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 22 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 23 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 24 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 25 | 2820462123 | Unclassified Firmicutes Lab288P3bin129 | Isolate | Unclassified |
| 26 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 27 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 28 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 29 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 30 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 31 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 32 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 33 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 34 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 35 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_334719 | 3300042612 | Bacteria | 3716 |
| 2 | Ga0466712_146559 | 3300042614 | Bacteria | 2049 |
| 3 | Ga0466728_380816 | 3300042620 | Bacteria | 3336 |
| 4 | Ga0123353_10609510 | 3300010167 | Unclassified | 1558 |
| 5 | Ga0123353_10744568 | 3300010167 | Bacteria | 1365 |
| 6 | JGI24698J34947_10005198 | 3300002449 | Bacteria | 7139 |
| 7 | JGI24698J34947_10013272 | 3300002449 | Bacteria | 4500 |
| 8 | JGI24698J34947_10059796 | 3300002449 | Bacteria | 1882 |
| 9 | JGI24695J34938_10008714 | 3300002450 | Bacteria | 5753 |
| 10 | Ga0466690_012507 | 3300042590 | Bacteria | 26466 |
| 11 | Ga0466690_194465 | 3300042590 | Bacteria | 3124 |
| 12 | Ga0466690_223245 | 3300042590 | Bacteria | 2363 |
| 13 | Ga0466692_067906 | 3300042591 | Bacteria | 8953 |
| 14 | Ga0466692_176647 | 3300042591 | Bacteria | 2227 |
| 15 | Ga0466691_021836 | 3300042593 | Bacteria | 2821 |
| 16 | Ga0466707_158014 | 3300042601 | Bacteria | 2196 |
| 17 | Ga0466716_040889 | 3300042605 | Bacteria | 3597 |
| 18 | Ga0466722_225399 | 3300042609 | Bacteria | 9538 |
| 19 | Ga0466708_096098 | 3300042652 | Bacteria | 4228 |
| 20 | Ga0466708_169263 | 3300042652 | Bacteria | 6593 |
| 21 | Ga0466727_202826 | 3300042655 | Bacteria | 21540 |
| 22 | Ga0466727_232610 | 3300042655 | Bacteria | 8230 |
| 23 | Ga0466712_096810 | 3300042614 | Bacteria | 7087 |
| 24 | Ga0466718_005386 | 3300042617 | Bacteria | 5069 |
| 25 | Ga0466718_022825 | 3300042617 | Bacteria | 2261 |
| 26 | Ga0466718_043278 | 3300042617 | Bacteria | 23190 |
| 27 | Ga0466728_255978 | 3300042620 | Bacteria | 6252 |
| 28 | Ga0466728_272776 | 3300042620 | Bacteria | 2220 |
| 29 | Ga0123356_10002065 | 3300010049 | Bacteria | 21651 |
| 30 | Ga0123356_10010240 | 3300010049 | Bacteria | 9221 |
| 31 | JGI24698J34947_10012920 | 3300002449 | Bacteria | 4563 |
| 32 | JGI24698J34947_10021322 | 3300002449 | Unclassified | 3486 |
| 33 | JGI24695J34938_10054154 | 3300002450 | Bacteria | 1741 |
| 34 | Ga0072941_1003349 | 3300005201 | Bacteria | 40356 |
| 35 | Ga0466690_266005 | 3300042590 | Unclassified | 1442 |
| 36 | Ga0466696_177778 | 3300042596 | Bacteria | 2312 |
| 37 | Ga0466696_292976 | 3300042596 | Bacteria | 2133 |
| 38 | Ga0466719_195435 | 3300042606 | Bacteria | 5569 |
| 39 | Ga0466709_152293 | 3300042648 | Bacteria | 2858 |
| 40 | Ga0466709_367977 | 3300042648 | Bacteria | 3979 |
| 41 | Ga0466705_198481 | 3300042612 | Bacteria | 4433 |
| 42 | Ga0466705_407166 | 3300042612 | Bacteria | 8961 |
| 43 | Ga0466712_017872 | 3300042614 | Unclassified | 5682 |
| 44 | Ga0466726_196049 | 3300042619 | Bacteria | 2059 |
| 45 | Ga0123353_10414211 | 3300010167 | Bacteria | 1999 |
| 46 | JGI24698J34947_10009648 | 3300002449 | Bacteria | 5290 |
| 47 | JGI24698J34947_10032809 | 3300002449 | Bacteria | 2725 |
| 48 | JGI24698J34947_10122863 | 3300002449 | Bacteria | 1123 |
| 49 | Ga0456237_0003741 | 3300041968 | Bacteria | 2455 |
| 50 | Ga0466691_227171 | 3300042593 | Unclassified | 1042 |
| 51 | Ga0466706_126122 | 3300042599 | Bacteria | 1985 |
| 52 | Ga0466707_348458 | 3300042601 | Bacteria | 1618 |
| 53 | Ga0466708_031196 | 3300042652 | Bacteria | 7631 |
| 54 | Ga0466708_140067 | 3300042652 | Unclassified | 2766 |
| 55 | Ga0466712_244123 | 3300042614 | Bacteria | 10350 |
| 56 | Ga0466723_028357 | 3300042618 | Unclassified | 7744 |
| 57 | Ga0466728_021536 | 3300042620 | Bacteria | 6897 |
| 58 | Ga0123353_10012240 | 3300010167 | Bacteria | 12176 |
| 59 | AustNasuHG_c1001573 | 3300000089 | Bacteria | 8227 |
| 60 | Ga0072941_1127444 | 3300005201 | Bacteria | 1459 |
| 61 | Ga0466691_127326 | 3300042593 | Bacteria | 12724 |
| 62 | Ga0466707_072913 | 3300042601 | Bacteria | 1217 |
| 63 | Ga0466716_150550 | 3300042605 | Bacteria | 5897 |
| 64 | Ga0466698_262231 | 3300042610 | Bacteria | 1241 |
| 65 | Ga0466708_036075 | 3300042652 | Bacteria | 4907 |
| 66 | Ga0466708_038896 | 3300042652 | Unclassified | 1228 |
| 67 | Ga0466708_148458 | 3300042652 | Bacteria | 5605 |
| 68 | Ga0466712_003642 | 3300042614 | Bacteria | 6398 |
| 69 | Ga0466712_297960 | 3300042614 | Bacteria | 5197 |
| 70 | Ga0466718_019948 | 3300042617 | Bacteria | 2576 |
| 71 | Ga0466718_154358 | 3300042617 | Bacteria | 4628 |
| 72 | JGI24698J34947_10003662 | 3300002449 | Bacteria | 8346 |
| 73 | JGI24698J34947_10007766 | 3300002449 | Bacteria | 5891 |
| 74 | JGI24702J35022_10014406 | 3300002462 | Unclassified | 4362 |
| 75 | Ga0072941_1006195 | 3300005201 | Unclassified | 8646 |
| 76 | Ga0466703_304894 | 3300042636 | Bacteria | 3869 |
| 77 | Ga0466709_234064 | 3300042648 | Bacteria | 1387 |
| 78 | Ga0466708_214464 | 3300042652 | Bacteria | 9284 |
| 79 | Ga0466708_379952 | 3300042652 | Bacteria | 1820 |
| 80 | Ga0466705_294400 | 3300042612 | Bacteria | 1153 |
| 81 | Ga0466732_219089 | 3300042656 | Bacteria | 12688 |
| 82 | Ga0466712_024091 | 3300042614 | Bacteria | 7686 |
| 83 | Ga0466723_131093 | 3300042618 | Bacteria | 6538 |
| 84 | Ga0466723_153386 | 3300042618 | Bacteria | 2187 |
| 85 | Ga0466728_154373 | 3300042620 | Bacteria | 4879 |
| 86 | JGI24698J34947_10018680 | 3300002449 | Unclassified | 3744 |
| 87 | JGI24698J34947_10043285 | 3300002449 | Bacteria | 2309 |
| 88 | JGI24698J34947_10066196 | 3300002449 | Bacteria | 1758 |
| 89 | Ga0072941_1029387 | 3300005201 | Bacteria | 6548 |
| 90 | Ga0466696_305187 | 3300042596 | Bacteria | 1275 |
| 91 | Ga0466699_113198 | 3300042597 | Bacteria | 2881 |
| 92 | Ga0466706_003489 | 3300042599 | Bacteria | 2255 |
| 93 | Ga0466707_123299 | 3300042601 | Bacteria | 1821 |
| 94 | Ga0466707_232558 | 3300042601 | Bacteria | 1249 |
| 95 | Ga0466719_319605 | 3300042606 | Bacteria | 4720 |
| 96 | Ga0466722_214364 | 3300042609 | Bacteria | 5014 |
| 97 | Ga0466704_117003 | 3300042643 | Unclassified | 1878 |
| 98 | Ga0466709_382506 | 3300042648 | Bacteria | 18808 |
| 99 | Ga0466708_200046 | 3300042652 | Bacteria | 3114 |
| 100 | Ga0466715_295713 | 3300042616 | Bacteria | 14746 |
| 101 | Ga0466723_014458 | 3300042618 | Bacteria | 3260 |
| 102 | Ga0466728_228424 | 3300042620 | Bacteria | 4418 |
| 103 | Ga0123356_10028463 | 3300010049 | Bacteria | 5235 |
| 104 | Ga0123353_10721264 | 3300010167 | Bacteria | 1394 |
| 105 | JGI24695J34938_10009913 | 3300002450 | Bacteria | 5260 |
| 106 | Ga0072941_1001045 | 3300005201 | Bacteria | 5855 |
| 107 | Ga0466696_052818 | 3300042596 | Bacteria | 10852 |
| 108 | Ga0466719_156872 | 3300042606 | Unclassified | 2102 |
| 109 | Ga0466722_027937 | 3300042609 | Bacteria | 29446 |
| 110 | Ga0466703_265205 | 3300042636 | Bacteria | 3731 |
| 111 | Ga0466708_383518 | 3300042652 | Unclassified | 2402 |
| 112 | Ga0466712_224608 | 3300042614 | Bacteria | 7458 |
| 113 | Ga0466712_237193 | 3300042614 | Bacteria | 2867 |
| 114 | Ga0466718_076149 | 3300042617 | Bacteria | 15780 |
| 115 | Ga0466723_012081 | 3300042618 | Bacteria | 14979 |
| 116 | Ga0466723_123537 | 3300042618 | Bacteria | 3741 |
| 117 | Ga0466726_409920 | 3300042619 | Unclassified | 1082 |
| 118 | Ga0466728_364046 | 3300042620 | Bacteria | 2175 |
| 119 | Ga0123353_10009739 | 3300010167 | Bacteria | 13312 |
| 120 | JGI24698J34947_10022210 | 3300002449 | Unclassified | 3406 |
| 121 | Ga0466692_184905 | 3300042591 | Bacteria | 1641 |
| 122 | Ga0466696_003642 | 3300042596 | Bacteria | 15302 |
| 123 | Ga0466716_386763 | 3300042605 | Unclassified | 1413 |
| 124 | Ga0466722_067659 | 3300042609 | Bacteria | 24708 |
| 125 | Ga0466703_284569 | 3300042636 | Bacteria | 27959 |
| 126 | Ga0466708_425657 | 3300042652 | Bacteria | 1745 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.