Protein Family IF08419
Metagenome
Isolate
182
Members
64
Samples
164
Scaffolds
301.77
Avg Length
Representative Sequence
- ID
- 3300042620|Ga0466728_164254|Ga0466728_164254_10974_11918
- Length
- 314 aa
- Sequence
- MEFNRRNFIRTTLSGAALAATAGFPVCAASDYKNEKAAPASSGAAELKLSFQEGIAPGKTLTEKFDWMEKLGVTGFEPGGGGLENRVAEIKNALKGRNIKVSAICAGFKGFILSTEQAVRDEFFGTMKTIIAAAGELGSTGVIMVPAFNGQKPCLPHTQETRNFLCEQLAILGNYAVEHGTTVILEPLNRKEAFFLRQVADAAAICRDVNHPGVRCMGDFWHMSEETSDMGAFISGGNYLQHVHIASRKRRSMPGEDGTADNYIEGFKALKMLGYDKYVSYECGCQGDRNKIVPESVKLLKEQWAEAEFPSVQN
Sample Types
Isolate
9.9%
Metagenome
90.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
28.6%
Blattidae
25.4%
Kalotermitidae
22.2%
Unclassified
7.9%
Termopsidae
6.3%
Rhinotermitidae
4.8%
Passalidae
3.2%
Hodotermitidae
1.6%
Taxonomy
Archaea
0
Bacteria
165
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 2 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 11 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 12 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 13 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 14 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 15 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 18 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 19 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 20 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 21 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 22 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 23 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 24 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 25 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 26 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 27 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 28 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 29 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 30 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 31 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 32 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 33 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 34 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 35 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 36 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 37 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 38 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 39 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 40 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 41 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 42 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 43 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 44 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 45 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 46 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 47 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 48 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 49 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 50 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 51 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 52 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 53 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 54 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 55 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 56 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 57 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 58 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 59 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 60 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 61 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 62 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 63 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 64 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466713_070348 | 3300042602 | Bacteria | 1497 |
| 2 | Ga0466722_095600 | 3300042609 | Bacteria | 18381 |
| 3 | Ga0466711_247858 | 3300042615 | Bacteria | 2657 |
| 4 | Ga0466715_571128 | 3300042616 | Bacteria | 4317 |
| 5 | Ga0466728_162491 | 3300042620 | Bacteria | 12329 |
| 6 | Ga0466728_164254 | 3300042620 | Bacteria | 12853 |
| 7 | Ga0466728_269892 | 3300042620 | Bacteria | 4502 |
| 8 | JGI24699J35502_11133510 | 3300002509 | Bacteria | 11319 |
| 9 | Ga0068305_10054256 | 3300005083 | Unclassified | 9273 |
| 10 | Ga0466705_274497 | 3300042612 | Bacteria | 21960 |
| 11 | Ga0466734_015538 | 3300042623 | Bacteria | 2722 |
| 12 | Ga0466734_125867 | 3300042623 | Bacteria | 1322 |
| 13 | Ga0466703_119011 | 3300042636 | Bacteria | 35131 |
| 14 | Ga0466704_036983 | 3300042643 | Unclassified | 2488 |
| 15 | Ga0466690_185699 | 3300042590 | Bacteria | 6825 |
| 16 | Ga0466693_326875 | 3300042592 | Bacteria | 2087 |
| 17 | Ga0466691_044486 | 3300042593 | Bacteria | 9356 |
| 18 | Ga0123357_10093044 | 3300009784 | Unclassified | 3920 |
| 19 | Ga0123354_10021045 | 3300010882 | Bacteria | 10274 |
| 20 | Ga0466733_198400 | 3300042659 | Bacteria | 123976 |
| 21 | Ga0466713_011955 | 3300042602 | Bacteria | 16135 |
| 22 | Ga0466713_087441 | 3300042602 | Bacteria | 17694 |
| 23 | Ga0466722_005132 | 3300042609 | Bacteria | 8107 |
| 24 | Ga0466710_209369 | 3300042613 | Bacteria | 2347 |
| 25 | Ga0466711_151417 | 3300042615 | Bacteria | 13610 |
| 26 | Ga0466723_304906 | 3300042618 | Bacteria | 4349 |
| 27 | Ga0466726_120169 | 3300042619 | Bacteria | 7398 |
| 28 | Ga0068302_10227837 | 3300005071 | Bacteria | 5498 |
| 29 | Ga0072941_1113029 | 3300005201 | Bacteria | 6425 |
| 30 | Ga0466735_212551 | 3300042624 | Bacteria | 4422 |
| 31 | Ga0466704_559205 | 3300042643 | Bacteria | 3903 |
| 32 | Ga0415639_184350 | 3300038395 | Bacteria | 3424 |
| 33 | Ga0466696_198401 | 3300042596 | Bacteria | 18411 |
| 34 | Ga0123357_10269795 | 3300009784 | Unclassified | 1781 |
| 35 | Ga0123356_10013052 | 3300010049 | Bacteria | 8037 |
| 36 | Ga0123354_10000454 | 3300010882 | Bacteria | 40443 |
| 37 | Ga0123354_10171842 | 3300010882 | Unclassified | 2517 |
| 38 | Ga0466733_054986 | 3300042659 | Bacteria | 147644 |
| 39 | Ga0466700_367785 | 3300042600 | Bacteria | 4543 |
| 40 | Ga0466713_050446 | 3300042602 | Bacteria | 1936 |
| 41 | Ga0466713_060435 | 3300042602 | Bacteria | 2423 |
| 42 | Ga0466716_116403 | 3300042605 | Bacteria | 6518 |
| 43 | Ga0466722_188108 | 3300042609 | Bacteria | 5088 |
| 44 | Ga0466715_464975 | 3300042616 | Bacteria | 101862 |
| 45 | Ga0466726_127835 | 3300042619 | Bacteria | 1800 |
| 46 | JGI24705J35276_12206433 | 3300002504 | Unclassified | 1720 |
| 47 | Ga0466705_001333 | 3300042612 | Bacteria | 8411 |
| 48 | Ga0466703_030953 | 3300042636 | Bacteria | 19202 |
| 49 | Ga0466709_397680 | 3300042648 | Bacteria | 7662 |
| 50 | Ga0466727_008778 | 3300042655 | Bacteria | 4067 |
| 51 | Ga0466690_075523 | 3300042590 | Bacteria | 11971 |
| 52 | Ga0466696_183403 | 3300042596 | Bacteria | 10099 |
| 53 | Ga0466696_274164 | 3300042596 | Bacteria | 16741 |
| 54 | Ga0466701_047556 | 3300042598 | Bacteria | 1429 |
| 55 | Ga0466706_247317 | 3300042599 | Bacteria | 3522 |
| 56 | Ga0466700_387813 | 3300042600 | Bacteria | 2747 |
| 57 | Ga0466713_030844 | 3300042602 | Bacteria | 14224 |
| 58 | Ga0466714_035339 | 3300042603 | Unclassified | 1344 |
| 59 | Ga0466719_170392 | 3300042606 | Bacteria | 14436 |
| 60 | Ga0466719_196297 | 3300042606 | Bacteria | 12318 |
| 61 | Ga0466719_474545 | 3300042606 | Bacteria | 7937 |
| 62 | Ga0466722_044020 | 3300042609 | Bacteria | 5180 |
| 63 | Ga0466722_063328 | 3300042609 | Bacteria | 8470 |
| 64 | Ga0466722_239940 | 3300042609 | Bacteria | 60486 |
| 65 | Ga0466715_200997 | 3300042616 | Bacteria | 7030 |
| 66 | Ga0466715_207676 | 3300042616 | Bacteria | 4931 |
| 67 | Ga0466723_053883 | 3300042618 | Bacteria | 24209 |
| 68 | IMNBL1DRAFT_c0001700 | 3300000062 | Bacteria | 16206 |
| 69 | JGI24702J35022_10030743 | 3300002462 | Bacteria | 2881 |
| 70 | Ga0068305_10536131 | 3300005083 | Unclassified | 2419 |
| 71 | Ga0466704_410682 | 3300042643 | Unclassified | 2520 |
| 72 | Ga0466690_089706 | 3300042590 | Bacteria | 19859 |
| 73 | Ga0466696_085403 | 3300042596 | Bacteria | 11374 |
| 74 | Ga0123356_10092462 | 3300010049 | Bacteria | 2884 |
| 75 | Ga0466733_149165 | 3300042659 | Bacteria | 9522 |
| 76 | Ga0466707_257140 | 3300042601 | Bacteria | 2159 |
| 77 | Ga0466707_274560 | 3300042601 | Bacteria | 4720 |
| 78 | Ga0466713_037887 | 3300042602 | Bacteria | 30344 |
| 79 | Ga0466713_070449 | 3300042602 | Bacteria | 62168 |
| 80 | Ga0466698_491575 | 3300042610 | Unclassified | 1203 |
| 81 | Ga0466711_023208 | 3300042615 | Bacteria | 1696 |
| 82 | Ga0466723_292055 | 3300042618 | Bacteria | 3941 |
| 83 | JGI24705J35276_12230591 | 3300002504 | Bacteria | 3674 |
| 84 | Ga0068302_10069925 | 3300005071 | Bacteria | 4619 |
| 85 | Ga0466704_192331 | 3300042643 | Bacteria | 2443 |
| 86 | Ga0466704_439822 | 3300042643 | Bacteria | 10207 |
| 87 | Ga0466708_112792 | 3300042652 | Bacteria | 43438 |
| 88 | Ga0466725_376299 | 3300042654 | Bacteria | 12483 |
| 89 | Ga0466727_046012 | 3300042655 | Bacteria | 12350 |
| 90 | Ga0466690_293895 | 3300042590 | Bacteria | 67504 |
| 91 | Ga0123357_10004531 | 3300009784 | Bacteria | 16344 |
| 92 | Ga0123357_10172040 | 3300009784 | Bacteria | 2559 |
| 93 | Ga0123354_10000124 | 3300010882 | Bacteria | 57938 |
| 94 | Ga0123354_10062047 | 3300010882 | Bacteria | 5509 |
| 95 | Ga0466707_001417 | 3300042601 | Bacteria | 1256 |
| 96 | Ga0466707_192130 | 3300042601 | Bacteria | 24568 |
| 97 | Ga0466716_240538 | 3300042605 | Bacteria | 31679 |
| 98 | Ga0466716_283056 | 3300042605 | Bacteria | 13321 |
| 99 | Ga0466719_117982 | 3300042606 | Unclassified | 1327 |
| 100 | Ga0466719_136344 | 3300042606 | Bacteria | 16493 |
| 101 | Ga0466722_050777 | 3300042609 | Bacteria | 13771 |
| 102 | Ga0466722_070791 | 3300042609 | Bacteria | 8121 |
| 103 | Ga0466711_445766 | 3300042615 | Bacteria | 24801 |
| 104 | Ga0466715_055279 | 3300042616 | Bacteria | 17646 |
| 105 | Ga0466715_093005 | 3300042616 | Bacteria | 8882 |
| 106 | Ga0466723_353155 | 3300042618 | Bacteria | 54178 |
| 107 | JGI24702J35022_10000411 | 3300002462 | Bacteria | 25600 |
| 108 | JGI24702J35022_10049994 | 3300002462 | Bacteria | 2227 |
| 109 | JGI24699J35502_11133892 | 3300002509 | Bacteria | 18422 |
| 110 | Ga0466705_019067 | 3300042612 | Bacteria | 11862 |
| 111 | Ga0466704_357496 | 3300042643 | Bacteria | 9073 |
| 112 | Ga0466704_448716 | 3300042643 | Bacteria | 23460 |
| 113 | Ga0466704_615300 | 3300042643 | Bacteria | 37603 |
| 114 | Ga0466727_134376 | 3300042655 | Bacteria | 1654 |
| 115 | Ga0466727_161502 | 3300042655 | Bacteria | 9956 |
| 116 | Ga0123357_10034549 | 3300009784 | Bacteria | 6874 |
| 117 | Ga0123357_10061038 | 3300009784 | Bacteria | 5053 |
| 118 | Ga0123357_10115173 | 3300009784 | Unclassified | 3409 |
| 119 | Ga0466713_017018 | 3300042602 | Bacteria | 51598 |
| 120 | Ga0466713_047193 | 3300042602 | Bacteria | 9247 |
| 121 | Ga0466713_065658 | 3300042602 | Unclassified | 4052 |
| 122 | Ga0466716_425371 | 3300042605 | Bacteria | 22742 |
| 123 | Ga0466720_076234 | 3300042607 | Unclassified | 1454 |
| 124 | Ga0466705_463643 | 3300042612 | Bacteria | 14476 |
| 125 | Ga0466715_098299 | 3300042616 | Bacteria | 65486 |
| 126 | Ga0466715_314686 | 3300042616 | Bacteria | 14830 |
| 127 | Ga0466726_214269 | 3300042619 | Bacteria | 12075 |
| 128 | 2227491038 | 2225789004 | Bacteria | 4077 |
| 129 | IMNBL1DRAFT_c0003686 | 3300000062 | Bacteria | 9657 |
| 130 | Ga0466705_248814 | 3300042612 | Bacteria | 14175 |
| 131 | Ga0466729_258925 | 3300042621 | Bacteria | 7251 |
| 132 | Ga0466735_007160 | 3300042624 | Bacteria | 5834 |
| 133 | Ga0466735_168350 | 3300042624 | Bacteria | 7222 |
| 134 | Ga0466704_070168 | 3300042643 | Bacteria | 7068 |
| 135 | Ga0466704_290370 | 3300042643 | Bacteria | 8439 |
| 136 | Ga0466709_177105 | 3300042648 | Bacteria | 35753 |
| 137 | Ga0466709_214534 | 3300042648 | Bacteria | 14150 |
| 138 | Ga0466727_055739 | 3300042655 | Bacteria | 13194 |
| 139 | Ga0466692_075279 | 3300042591 | Bacteria | 15517 |
| 140 | Ga0123357_10067990 | 3300009784 | Bacteria | 4744 |
| 141 | Ga0466707_111695 | 3300042601 | Bacteria | 37145 |
| 142 | Ga0466707_143824 | 3300042601 | Unclassified | 2408 |
| 143 | Ga0466716_145095 | 3300042605 | Bacteria | 9724 |
| 144 | Ga0466719_011954 | 3300042606 | Bacteria | 18691 |
| 145 | Ga0466719_247451 | 3300042606 | Bacteria | 4750 |
| 146 | Ga0466719_454292 | 3300042606 | Bacteria | 3483 |
| 147 | Ga0466721_142083 | 3300042608 | Bacteria | 12871 |
| 148 | Ga0466711_136845 | 3300042615 | Bacteria | 6998 |
| 149 | Ga0466711_191054 | 3300042615 | Bacteria | 22747 |
| 150 | Ga0466711_223785 | 3300042615 | Bacteria | 4125 |
| 151 | Ga0466715_002630 | 3300042616 | Bacteria | 2225 |
| 152 | Ga0466715_465080 | 3300042616 | Bacteria | 29846 |
| 153 | Ga0466728_357319 | 3300042620 | Unclassified | 2280 |
| 154 | JGI24702J35022_10029625 | 3300002462 | Bacteria | 2937 |
| 155 | Ga0466735_036490 | 3300042624 | Unclassified | 1723 |
| 156 | Ga0466704_449061 | 3300042643 | Bacteria | 12220 |
| 157 | Ga0466709_111435 | 3300042648 | Bacteria | 34195 |
| 158 | Ga0466708_196348 | 3300042652 | Bacteria | 5125 |
| 159 | Ga0466708_420546 | 3300042652 | Bacteria | 9577 |
| 160 | Ga0466691_081756 | 3300042593 | Bacteria | 5902 |
| 161 | Ga0466696_079106 | 3300042596 | Bacteria | 14883 |
| 162 | Ga0123357_10065826 | 3300009784 | Bacteria | 4836 |
| 163 | Ga0123354_10000732 | 3300010882 | Bacteria | 35329 |
| 164 | Ga0123354_10161280 | 3300010882 | Bacteria | 2660 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01261 | AP_endonuc_2 | Xylose isomerase-like TIM barrel | 65 | 302 | 0.9 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.