Protein Family IF08397

Metagenome Isolate
236 Members
54 Samples
231 Scaffolds
128.09 Avg Length

🧬 Representative Sequence

ID
3300042620|Ga0466728_086442|Ga0466728_086442_1354_1782
Length
142 aa
Sequence
VLRFLTLSEVLLILEDQIRNYGGTYGVRDINLLSSALHMPQSSFDGQYLHETVPAMAAAYAFHICQNHPFIDGNKRVSLASSLVFLDINEHTFNFDDETLYNEIINMAKGEIKKEDLIKYFEKSAKKSVDCVESQTTPSYNP

📊 Sample Types

Isolate 2.1%
Metagenome 97.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 46.2%
Kalotermitidae 26.9%
Unclassified 11.5%
Termopsidae 7.7%
Rhinotermitidae 3.8%
Blaberidae 1.9%
Hodotermitidae 1.9%

🌳 Taxonomy

Archaea 4
Bacteria 206
Eukaryota 0
Viruses 1
Unclassified 25

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
2 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
3 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
4 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
5 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
6 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
7 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
8 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
9 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
10 2772190975 Treponema sp. RmG30 Isolate Blaberidae
11 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
12 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
13 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
14 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
15 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
16 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
17 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
18 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
19 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
20 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
21 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
22 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
23 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
24 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
25 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
26 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
27 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
28 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
29 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
30 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
31 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
32 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
33 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
34 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
35 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
36 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
37 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
38 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
39 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
40 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
41 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
42 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
43 2820010479 Unclassified Spirochaetes Th196P4bin55 Isolate Unclassified
44 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
45 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
46 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
47 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
48 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
49 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
50 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
51 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
52 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
53 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
54 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 JGI24698J34947_10020101 3300002449 Bacteria 3600
2 JGI24698J34947_10144660 3300002449 Bacteria 996
3 JGI24695J34938_10534031 3300002450 Bacteria 540
4 Ga0072941_1007077 3300005201 Bacteria 19449
5 Ga0466712_016782 3300042614 Bacteria 18547
6 Ga0466712_127075 3300042614 Bacteria 33532
7 Ga0466712_157532 3300042614 Unclassified 1585
8 Ga0466711_095482 3300042615 Bacteria 1386
9 Ga0466711_253552 3300042615 Unclassified 2489
10 Ga0466711_474473 3300042615 Bacteria 1288
11 Ga0466715_597468 3300042616 Bacteria 2069
12 Ga0466718_001572 3300042617 Bacteria 1126
13 Ga0466718_028887 3300042617 Bacteria 3412
14 Ga0466718_119699 3300042617 Bacteria 1427
15 Ga0466726_244295 3300042619 Bacteria 1407
16 Ga0466728_191098 3300042620 Bacteria 1160
17 Ga0123356_10953057 3300010049 Bacteria 1029
18 Ga0123353_10479005 3300010167 Bacteria 1822
19 Ga0123354_10370376 3300010882 Bacteria 1251
20 Ga0264413_101742 3300024493 Bacteria 7039
21 Ga0264413_106382 3300024493 Unclassified 4751
22 Ga0264413_108051 3300024493 Bacteria 1941
23 Ga0466692_122412 3300042591 Bacteria 1594
24 Ga0466691_141531 3300042593 Bacteria 4258
25 Ga0466699_015073 3300042597 Bacteria 5447
26 Ga0466701_064905 3300042598 Bacteria 1084
27 Ga0466713_089499 3300042602 Bacteria 1026
28 AustNasuHG_c1015893 3300000089 Bacteria 2530
29 JGI24695J34938_10203552 3300002450 Bacteria 826
30 JGI24702J35022_10027606 3300002462 Archaea 3053
31 Ga0466712_051766 3300042614 Bacteria 4122
32 Ga0466712_289449 3300042614 Bacteria 4036
33 Ga0466715_321893 3300042616 Unclassified 2110
34 Ga0466718_082435 3300042617 Archaea 1587
35 Ga0466718_085509 3300042617 Bacteria 3973
36 Ga0466726_054653 3300042619 Bacteria 5926
37 Ga0466726_423698 3300042619 Unclassified 1325
38 Ga0123353_11433439 3300010167 Bacteria 885
39 Ga0466692_002215 3300042591 Bacteria 38338
40 Ga0466692_012233 3300042591 Bacteria 5337
41 Ga0466691_099301 3300042593 Bacteria 9448
42 Ga0466735_182103 3300042624 Bacteria 1351
43 Ga0466702_239870 3300042635 Bacteria 2066
44 Ga0466702_431039 3300042635 Bacteria 1466
45 Ga0466708_291578 3300042652 Unclassified 7378
46 Ga0466707_280677 3300042601 Bacteria 5662
47 Ga0466720_074691 3300042607 Bacteria 1131
48 Ga0466720_098439 3300042607 Bacteria 1890
49 Ga0466720_170736 3300042607 Bacteria 11332
50 Ga0466720_202236 3300042607 Bacteria 5962
51 Ga0466722_073477 3300042609 Bacteria 1616
52 Ga0466698_150261 3300042610 Bacteria 1445
53 JGI24698J34947_10001489 3300002449 Bacteria 12376
54 JGI24698J34947_10156732 3300002449 Bacteria 938
55 JGI24698J34947_10198615 3300002449 Bacteria 787
56 Ga0074263_140898 3300005485 Bacteria 888
57 Ga0466711_180832 3300042615 Bacteria 1177
58 Ga0123353_10960183 3300010167 Bacteria 1155
59 Ga0123353_11133454 3300010167 Bacteria 1034
60 Ga0123353_13221131 3300010167 Bacteria 523
61 Ga0466691_011637 3300042593 Bacteria 61350
62 Ga0466694_380803 3300042594 Bacteria 1465
63 Ga0466699_200204 3300042597 Bacteria 1464
64 Ga0466735_171676 3300042624 Bacteria 1248
65 Ga0466702_195270 3300042635 Bacteria 1576
66 Ga0466703_244860 3300042636 Bacteria 1140
67 Ga0466704_323876 3300042643 Unclassified 2317
68 Ga0466709_235006 3300042648 Bacteria 1446
69 Ga0466706_214276 3300042599 Bacteria 1175
70 Ga0466700_388694 3300042600 Bacteria 1051
71 Ga0466716_046475 3300042605 Viruses 2205
72 Ga0466719_146385 3300042606 Bacteria 1665
73 Ga0466720_005363 3300042607 Bacteria 3587
74 Ga0466720_078074 3300042607 Bacteria 9694
75 Ga0466722_262852 3300042609 Bacteria 1191
76 JGI24698J34947_10000020 3300002449 Bacteria 40728
77 JGI24698J34947_10054051 3300002449 Bacteria 2007
78 JGI24695J34938_10371718 3300002450 Bacteria 632
79 JGI24695J34938_10422603 3300002450 Bacteria 598
80 Ga0466712_031057 3300042614 Bacteria 1898
81 Ga0466712_224687 3300042614 Bacteria 3096
82 Ga0466712_260719 3300042614 Bacteria 20517
83 Ga0466712_312691 3300042614 Bacteria 3453
84 Ga0123357_10152371 3300009784 Bacteria 2800
85 Ga0123356_11200552 3300010049 Bacteria 925
86 Ga0123353_10119961 3300010167 Bacteria 4229
87 Ga0123353_11032674 3300010167 Bacteria 1100
88 Ga0123353_11145829 3300010167 Bacteria 1027
89 Ga0466691_136123 3300042593 Unclassified 10493
90 Ga0466734_033638 3300042623 Bacteria 1049
91 Ga0466702_171419 3300042635 Bacteria 1327
92 Ga0466727_266569 3300042655 Bacteria 1410
93 Ga0466719_190408 3300042606 Bacteria 1130
94 Ga0466719_441820 3300042606 Bacteria 1242
95 Ga0466705_158657 3300042612 Bacteria 22070
96 Ga0466732_297626 3300042656 Unclassified 1789
97 AustNasuHG_c1010074 3300000089 Bacteria 3303
98 JGI24698J34947_10018125 3300002449 Bacteria 3809
99 JGI24698J34947_10028141 3300002449 Bacteria 2977
100 JGI24698J34947_10045268 3300002449 Bacteria 2247
101 JGI24698J34947_10326878 3300002449 Unclassified 544
102 JGI24695J34938_10001806 3300002450 Bacteria 17573
103 JGI24702J35022_10018804 3300002462 Bacteria 3765
104 JGI24705J35276_12071364 3300002504 Bacteria 954
105 Ga0072941_1275365 3300005201 Bacteria 1296
106 Ga0466712_108628 3300042614 Bacteria 4389
107 Ga0466712_318000 3300042614 Archaea 1861
108 Ga0466718_007407 3300042617 Bacteria 3649
109 Ga0466718_030921 3300042617 Bacteria 1625
110 Ga0466723_115701 3300042618 Bacteria 2168
111 Ga0466726_340243 3300042619 Bacteria 1210
112 Ga0466726_457086 3300042619 Unclassified 1327
113 Ga0466728_199251 3300042620 Unclassified 1285
114 Ga0123353_10856680 3300010167 Bacteria 1244
115 Ga0123354_10216380 3300010882 Bacteria 2052
116 Ga0123354_10415352 3300010882 Bacteria 1124
117 Ga0466690_008163 3300042590 Bacteria 2746
118 Ga0466690_076913 3300042590 Bacteria 37761
119 Ga0466691_000304 3300042593 Bacteria 2295
120 Ga0466699_094711 3300042597 Unclassified 1049
121 Ga0466734_167840 3300042623 Bacteria 1030
122 Ga0466702_375698 3300042635 Bacteria 1562
123 Ga0466703_111761 3300042636 Bacteria 3516
124 Ga0466706_226851 3300042599 Bacteria 1262
125 Ga0466700_226245 3300042600 Bacteria 1167
126 Ga0466707_390943 3300042601 Unclassified 1748
127 Ga0466716_204273 3300042605 Bacteria 1279
128 Ga0466716_406693 3300042605 Bacteria 1503
129 Ga0466720_008088 3300042607 Bacteria 3770
130 Ga0466720_027006 3300042607 Bacteria 14799
131 Ga0466698_322007 3300042610 Bacteria 1328
132 Ga0466733_200778 3300042659 Bacteria 1264
133 AustNasuHG_c1031083 3300000089 Bacteria 1518
134 JGI24698J34947_10013083 3300002449 Bacteria 4533
135 JGI24698J34947_10044856 3300002449 Bacteria 2260
136 JGI24702J35022_10025860 3300002462 Bacteria 3165
137 JGI24702J35022_10806656 3300002462 Bacteria 585
138 Ga0072941_1028091 3300005201 Bacteria 5906
139 Ga0072941_1089694 3300005201 Bacteria 3739
140 Ga0466711_394700 3300042615 Bacteria 1070
141 Ga0466726_144122 3300042619 Bacteria 1218
142 Ga0466726_308399 3300042619 Bacteria 1281
143 Ga0123357_10373079 3300009784 Unclassified 1334
144 Ga0123356_12023870 3300010049 Bacteria 718
145 Ga0123353_10817942 3300010167 Bacteria 1283
146 Ga0123353_12316166 3300010167 Bacteria 645
147 Ga0466690_065609 3300042590 Bacteria 1377
148 Ga0466690_241683 3300042590 Bacteria 2073
149 Ga0466703_067383 3300042636 Bacteria 153289
150 Ga0466709_076075 3300042648 Bacteria 7529
151 Ga0466708_077978 3300042652 Bacteria 1713
152 Ga0466706_190044 3300042599 Bacteria 1098
153 Ga0466707_148697 3300042601 Bacteria 2378
154 Ga0466716_012317 3300042605 Bacteria 3821
155 Ga0466722_070600 3300042609 Bacteria 1104
156 Ga0466697_058668 3300042611 Bacteria 2697
157 Ga0466732_064853 3300042656 Archaea 3084
158 Ga0466732_223365 3300042656 Bacteria 1028
159 JGI24698J34947_10046673 3300002449 Unclassified 2202
160 JGI24698J34947_10048859 3300002449 Bacteria 2140
161 JGI24698J34947_10072132 3300002449 Unclassified 1654
162 JGI24698J34947_10088019 3300002449 Unclassified 1434
163 JGI24702J35022_10018402 3300002462 Bacteria 3810
164 JGI24702J35022_10275478 3300002462 Unclassified 986
165 JGI24705J35276_12150756 3300002504 Bacteria 1182
166 Ga0068302_10005451 3300005071 Bacteria 3725
167 Ga0072940_1163355 3300005200 Bacteria 1390
168 Ga0466712_004271 3300042614 Bacteria 18054
169 Ga0466712_029212 3300042614 Bacteria 5093
170 Ga0466712_102310 3300042614 Bacteria 1364
171 Ga0466711_411180 3300042615 Bacteria 25292
172 Ga0466715_142824 3300042616 Bacteria 1793
173 Ga0466715_546918 3300042616 Bacteria 1366
174 Ga0466718_091810 3300042617 Bacteria 2955
175 Ga0466723_077653 3300042618 Unclassified 1771
176 Ga0466723_108417 3300042618 Bacteria 1147
177 Ga0466723_286289 3300042618 Bacteria 1274
178 Ga0466728_020709 3300042620 Bacteria 2421
179 Ga0466728_056924 3300042620 Bacteria 2168
180 Ga0466728_086442 3300042620 Bacteria 15896
181 Ga0123357_10428409 3300009784 Bacteria 1172
182 Ga0123356_12253154 3300010049 Bacteria 681
183 Ga0264413_120802 3300024493 Bacteria 1995
184 Ga0466691_089334 3300042593 Unclassified 2183
185 Ga0466696_349461 3300042596 Bacteria 1125
186 Ga0466699_045078 3300042597 Bacteria 1487
187 Ga0466735_015316 3300042624 Bacteria 8171
188 Ga0466735_107441 3300042624 Bacteria 1022
189 Ga0466703_124875 3300042636 Bacteria 1591
190 Ga0466704_038035 3300042643 Bacteria 41527
191 Ga0466709_214866 3300042648 Bacteria 1607
192 Ga0466708_180837 3300042652 Unclassified 1525
193 Ga0466727_325290 3300042655 Bacteria 4845
194 Ga0466706_238278 3300042599 Bacteria 1213
195 Ga0466720_165583 3300042607 Bacteria 2221
196 Ga0466732_176115 3300042656 Bacteria 2580
197 Ga0466732_230770 3300042656 Bacteria 1788
198 Ga0466732_268652 3300042656 Bacteria 1282
199 AustNasuHG_c1002252 3300000089 Bacteria 6957
200 JGI24698J34947_10000191 3300002449 Bacteria 24630
201 JGI24698J34947_10032136 3300002449 Unclassified 2757
202 JGI24695J34938_10001216 3300002450 Bacteria 22813
203 JGI24695J34938_10195089 3300002450 Bacteria 842
204 JGI24695J34938_10608594 3300002450 Bacteria 509
205 JGI24702J35022_10011631 3300002462 Bacteria 4905
206 JGI24702J35022_10375150 3300002462 Bacteria 855
207 JGI24702J35022_10430541 3300002462 Bacteria 801
208 Ga0072941_1003408 3300005201 Bacteria 36537
209 Ga0466712_163954 3300042614 Bacteria 1151
210 Ga0466711_227264 3300042615 Bacteria 1271
211 Ga0466711_460272 3300042615 Bacteria 11179
212 Ga0466723_187731 3300042618 Bacteria 4617
213 Ga0466726_326862 3300042619 Unclassified 1202
214 Ga0466726_461663 3300042619 Bacteria 1229
215 Ga0123356_10003147 3300010049 Bacteria 17376
216 Ga0123356_10602701 3300010049 Bacteria 1263
217 Ga0123356_10656007 3300010049 Bacteria 1217
218 Ga0123356_11332293 3300010049 Bacteria 880
219 Ga0123356_11409754 3300010049 Bacteria 857
220 Ga0123353_10132725 3300010167 Bacteria 3995
221 Ga0123354_10538950 3300010882 Bacteria 887
222 Ga0466690_255032 3300042590 Bacteria 1390
223 Ga0466694_006106 3300042594 Bacteria 6247
224 Ga0466694_094963 3300042594 Bacteria 1162
225 Ga0466703_251828 3300042636 Unclassified 4200
226 Ga0466709_123749 3300042648 Bacteria 3609
227 Ga0466727_325549 3300042655 Bacteria 1445
228 Ga0466700_290364 3300042600 Bacteria 1170
229 Ga0466722_146769 3300042609 Bacteria 1503
230 Ga0466698_332634 3300042610 Bacteria 1283
231 Ga0466698_356246 3300042610 Bacteria 1705

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02661 Fic Fic/DOC family 5 86 0.93

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.