Protein Family IF08360
Metagenome
Isolate
138
Members
30
Samples
137
Scaffolds
317.02
Avg Length
Representative Sequence
- ID
- 3300042619|Ga0466726_465311|Ga0466726_465311_976_2031
- Length
- 351 aa
- Sequence
- MVLQSKLYPAVLPGFAPMAAAAGQYSLRRKFMKVKAFILTAVLFAALVFGAYAKGGAQGTQQIRMATGGNTGTYYAYGSAVGQILTEKTGIPITIQSTGASKANIQLIAAGDVELAIVQNDVMDYAYKGIDLFNGEKITAFSTMAALYAEVCQVVANPASGIRTIADLKGKNVSVGDAGSGTELNARQILEAYGVTFDDIRKQNLSFGASADALRDNKIDAFFCVAGAPTTAIVDLAIGKEIVVLDIDDAHAVALSQKYPFYTQFPIPAGSYRGQNSAVKTVAVKATFIVSTKLSDDTVYSLTKNLLESKQAIVAAHAKGSELSSEYAVSGISVPFHPGAEKYLREIGALK
Sample Types
Isolate
0.7%
Metagenome
99.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
46.7%
Termitidae
16.7%
Unclassified
10.0%
Rhinotermitidae
10.0%
Termopsidae
10.0%
Passalidae
3.3%
Hodotermitidae
3.3%
Taxonomy
Archaea
1
Bacteria
114
Eukaryota
0
Viruses
0
Unclassified
23
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 2 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 3 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 4 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 5 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 6 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 7 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 8 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 9 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 10 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 11 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 12 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 13 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 14 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 15 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 16 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 17 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 18 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 19 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 20 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 21 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 22 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 23 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 24 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 25 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 26 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 27 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 28 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 29 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 30 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466692_094517 | 3300042591 | Unclassified | 2408 |
| 2 | Ga0466692_183837 | 3300042591 | Bacteria | 23012 |
| 3 | Ga0466691_067489 | 3300042593 | Bacteria | 5349 |
| 4 | Ga0466696_329025 | 3300042596 | Bacteria | 7950 |
| 5 | Ga0466696_403183 | 3300042596 | Unclassified | 1256 |
| 6 | Ga0466713_087932 | 3300042602 | Bacteria | 24748 |
| 7 | Ga0466722_165807 | 3300042609 | Bacteria | 19197 |
| 8 | Ga0466715_440436 | 3300042616 | Bacteria | 24382 |
| 9 | Ga0466715_541118 | 3300042616 | Bacteria | 23249 |
| 10 | Ga0466723_074762 | 3300042618 | Bacteria | 12215 |
| 11 | Ga0466726_057695 | 3300042619 | Bacteria | 1965 |
| 12 | Ga0466703_150251 | 3300042636 | Unclassified | 2799 |
| 13 | Ga0466704_273998 | 3300042643 | Unclassified | 2246 |
| 14 | Ga0466708_080950 | 3300042652 | Unclassified | 2426 |
| 15 | Ga0466708_085239 | 3300042652 | Bacteria | 30570 |
| 16 | Ga0466727_082501 | 3300042655 | Bacteria | 1734 |
| 17 | Ga0466733_022732 | 3300042659 | Bacteria | 28799 |
| 18 | Ga0466690_016976 | 3300042590 | Unclassified | 9145 |
| 19 | Ga0466692_010681 | 3300042591 | Bacteria | 32497 |
| 20 | Ga0466692_202113 | 3300042591 | Bacteria | 3225 |
| 21 | Ga0466691_016325 | 3300042593 | Bacteria | 11766 |
| 22 | Ga0466716_203659 | 3300042605 | Bacteria | 2793 |
| 23 | Ga0466719_016516 | 3300042606 | Bacteria | 10555 |
| 24 | Ga0466719_277749 | 3300042606 | Bacteria | 18545 |
| 25 | Ga0466722_009039 | 3300042609 | Bacteria | 23176 |
| 26 | Ga0466722_197828 | 3300042609 | Unclassified | 1139 |
| 27 | Ga0466726_465311 | 3300042619 | Bacteria | 2786 |
| 28 | Ga0466703_060394 | 3300042636 | Bacteria | 7926 |
| 29 | Ga0466704_409051 | 3300042643 | Bacteria | 10608 |
| 30 | Ga0466709_150515 | 3300042648 | Bacteria | 8213 |
| 31 | Ga0466709_239318 | 3300042648 | Unclassified | 3882 |
| 32 | Ga0466708_303006 | 3300042652 | Unclassified | 1743 |
| 33 | Ga0466705_271200 | 3300042612 | Bacteria | 5897 |
| 34 | Ga0466690_030572 | 3300042590 | Bacteria | 18022 |
| 35 | Ga0466690_283388 | 3300042590 | Bacteria | 14677 |
| 36 | Ga0466692_008402 | 3300042591 | Bacteria | 5328 |
| 37 | Ga0466691_053028 | 3300042593 | Unclassified | 2946 |
| 38 | Ga0466707_203220 | 3300042601 | Bacteria | 2214 |
| 39 | Ga0466716_068037 | 3300042605 | Unclassified | 2677 |
| 40 | Ga0466716_308675 | 3300042605 | Unclassified | 7685 |
| 41 | Ga0466716_312354 | 3300042605 | Bacteria | 2875 |
| 42 | Ga0466722_022089 | 3300042609 | Bacteria | 10999 |
| 43 | Ga0466711_016323 | 3300042615 | Bacteria | 32034 |
| 44 | Ga0466715_295077 | 3300042616 | Bacteria | 8106 |
| 45 | Ga0466723_161240 | 3300042618 | Bacteria | 5420 |
| 46 | Ga0466723_360356 | 3300042618 | Bacteria | 17355 |
| 47 | Ga0466726_117995 | 3300042619 | Archaea | 1424 |
| 48 | Ga0466726_177351 | 3300042619 | Bacteria | 2415 |
| 49 | Ga0466726_206714 | 3300042619 | Bacteria | 4658 |
| 50 | Ga0466728_339243 | 3300042620 | Bacteria | 11162 |
| 51 | Ga0466704_135516 | 3300042643 | Bacteria | 50760 |
| 52 | Ga0466727_224371 | 3300042655 | Bacteria | 12973 |
| 53 | Ga0466692_144206 | 3300042591 | Unclassified | 2456 |
| 54 | Ga0466691_063397 | 3300042593 | Bacteria | 3844 |
| 55 | Ga0466696_041253 | 3300042596 | Bacteria | 18008 |
| 56 | Ga0466713_156709 | 3300042602 | Bacteria | 2709 |
| 57 | Ga0466716_103489 | 3300042605 | Bacteria | 23373 |
| 58 | Ga0466722_019497 | 3300042609 | Bacteria | 4818 |
| 59 | Ga0466722_054085 | 3300042609 | Bacteria | 6871 |
| 60 | Ga0466711_476427 | 3300042615 | Bacteria | 3345 |
| 61 | Ga0466726_299586 | 3300042619 | Bacteria | 28168 |
| 62 | Ga0466703_031517 | 3300042636 | Bacteria | 15283 |
| 63 | Ga0466703_206719 | 3300042636 | Bacteria | 8783 |
| 64 | Ga0466703_213291 | 3300042636 | Bacteria | 34230 |
| 65 | Ga0466704_502947 | 3300042643 | Bacteria | 3931 |
| 66 | Ga0466708_077091 | 3300042652 | Bacteria | 2296 |
| 67 | Ga0466708_152751 | 3300042652 | Bacteria | 9068 |
| 68 | Ga0466733_129372 | 3300042659 | Bacteria | 7225 |
| 69 | Ga0466692_003088 | 3300042591 | Bacteria | 16524 |
| 70 | Ga0466692_171101 | 3300042591 | Bacteria | 3940 |
| 71 | Ga0466692_200599 | 3300042591 | Unclassified | 1062 |
| 72 | Ga0466691_090688 | 3300042593 | Bacteria | 1974 |
| 73 | Ga0466700_457604 | 3300042600 | Bacteria | 2159 |
| 74 | Ga0466719_163458 | 3300042606 | Bacteria | 27156 |
| 75 | Ga0466711_463684 | 3300042615 | Bacteria | 8627 |
| 76 | Ga0466726_145622 | 3300042619 | Bacteria | 6519 |
| 77 | Ga0466726_216950 | 3300042619 | Unclassified | 1113 |
| 78 | Ga0466726_265651 | 3300042619 | Bacteria | 2291 |
| 79 | Ga0466726_300296 | 3300042619 | Bacteria | 8689 |
| 80 | Ga0466728_101966 | 3300042620 | Bacteria | 40822 |
| 81 | IMNBL1DRAFT_c0000597 | 3300000062 | Bacteria | 29012 |
| 82 | Ga0466704_139799 | 3300042643 | Unclassified | 1949 |
| 83 | Ga0466709_017970 | 3300042648 | Bacteria | 2317 |
| 84 | Ga0466709_161517 | 3300042648 | Bacteria | 4333 |
| 85 | Ga0466727_137904 | 3300042655 | Unclassified | 2263 |
| 86 | Ga0466691_100904 | 3300042593 | Bacteria | 2649 |
| 87 | Ga0123357_10125567 | 3300009784 | Bacteria | 3216 |
| 88 | Ga0466722_059476 | 3300042609 | Bacteria | 18974 |
| 89 | Ga0466723_149815 | 3300042618 | Bacteria | 17280 |
| 90 | Ga0466723_251920 | 3300042618 | Bacteria | 10899 |
| 91 | Ga0466723_275897 | 3300042618 | Bacteria | 48405 |
| 92 | Ga0466723_278903 | 3300042618 | Bacteria | 5486 |
| 93 | Ga0466726_311027 | 3300042619 | Bacteria | 4857 |
| 94 | Ga0466728_324562 | 3300042620 | Bacteria | 5408 |
| 95 | Ga0466709_124551 | 3300042648 | Bacteria | 15476 |
| 96 | Ga0466708_038995 | 3300042652 | Bacteria | 14766 |
| 97 | Ga0466727_031122 | 3300042655 | Unclassified | 3070 |
| 98 | Ga0466727_309132 | 3300042655 | Unclassified | 2011 |
| 99 | Ga0466705_083588 | 3300042612 | Bacteria | 10237 |
| 100 | Ga0466705_203390 | 3300042612 | Bacteria | 5234 |
| 101 | Ga0466733_207889 | 3300042659 | Bacteria | 3100 |
| 102 | Ga0466692_118660 | 3300042591 | Bacteria | 2325 |
| 103 | Ga0466691_120832 | 3300042593 | Bacteria | 3914 |
| 104 | Ga0466691_149608 | 3300042593 | Unclassified | 17073 |
| 105 | Ga0466691_217358 | 3300042593 | Bacteria | 12281 |
| 106 | Ga0466706_007306 | 3300042599 | Bacteria | 3361 |
| 107 | Ga0466719_041733 | 3300042606 | Bacteria | 9409 |
| 108 | Ga0466719_224892 | 3300042606 | Bacteria | 1901 |
| 109 | Ga0466719_442352 | 3300042606 | Bacteria | 4981 |
| 110 | Ga0466726_210047 | 3300042619 | Bacteria | 4241 |
| 111 | Ga0466729_227763 | 3300042621 | Bacteria | 2464 |
| 112 | Ga0466735_010612 | 3300042624 | Bacteria | 8361 |
| 113 | Ga0466704_332025 | 3300042643 | Bacteria | 4223 |
| 114 | Ga0466704_363378 | 3300042643 | Bacteria | 6622 |
| 115 | Ga0466708_030969 | 3300042652 | Bacteria | 51477 |
| 116 | Ga0466705_278397 | 3300042612 | Bacteria | 14446 |
| 117 | Ga0466705_279572 | 3300042612 | Bacteria | 5870 |
| 118 | Ga0466690_077207 | 3300042590 | Unclassified | 1336 |
| 119 | Ga0466690_289902 | 3300042590 | Bacteria | 4425 |
| 120 | Ga0466692_043992 | 3300042591 | Bacteria | 6997 |
| 121 | Ga0466692_107915 | 3300042591 | Bacteria | 12436 |
| 122 | Ga0466691_016173 | 3300042593 | Bacteria | 7004 |
| 123 | Ga0466706_239004 | 3300042599 | Bacteria | 10762 |
| 124 | Ga0466707_094169 | 3300042601 | Bacteria | 2599 |
| 125 | Ga0466707_293159 | 3300042601 | Bacteria | 2735 |
| 126 | Ga0466713_093987 | 3300042602 | Bacteria | 13299 |
| 127 | Ga0466716_421483 | 3300042605 | Bacteria | 7572 |
| 128 | Ga0466722_089413 | 3300042609 | Bacteria | 4949 |
| 129 | Ga0466712_187407 | 3300042614 | Bacteria | 6142 |
| 130 | Ga0466711_176014 | 3300042615 | Bacteria | 31697 |
| 131 | Ga0466711_223035 | 3300042615 | Bacteria | 5805 |
| 132 | Ga0466718_076958 | 3300042617 | Bacteria | 5916 |
| 133 | Ga0466718_112761 | 3300042617 | Bacteria | 1701 |
| 134 | Ga0466723_025497 | 3300042618 | Bacteria | 1775 |
| 135 | Ga0466735_023960 | 3300042624 | Bacteria | 2610 |
| 136 | Ga0466703_058642 | 3300042636 | Unclassified | 10733 |
| 137 | Ga0466727_138384 | 3300042655 | Unclassified | 2853 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.