Protein Family IF08349
Metagenome
Metatranscriptome
Isolate
153
Members
51
Samples
146
Scaffolds
87.73
Avg Length
Representative Sequence
- ID
- 3300042619|Ga0466726_435536|Ga0466726_435536_7719_8030
- Length
- 103 aa
- Sequence
- MKSKKNAPKGREDRRMPETQDRNRRKTRVGMVVSDKMDKTVVVAVEDFVRHSLYGKAVKRTKKFKAHDEENQCNIGDKVRIMETRPISKDKRWRLVNIIEKVK
Sample Types
Isolate
4.6%
Metagenome
94.1%
MAG
0.0%
Metatranscriptome
1.3%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
43.1%
Kalotermitidae
23.5%
Unclassified
17.6%
Rhinotermitidae
5.9%
Termopsidae
5.9%
Hodotermitidae
2.0%
Blattidae
2.0%
Taxonomy
Archaea
0
Bacteria
140
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820487239 | Unclassified Firmicutes Lab288P1bin71 | Isolate | Unclassified |
| 2 | 2820520043 | Unclassified Firmicutes Lab288P1bin24 | Isolate | Unclassified |
| 3 | 2820593525 | Unclassified Firmicutes Emb289P1bin7 | Isolate | Unclassified |
| 4 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 5 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 6 | 3300021227 | Termite gut microbial communities from nest from French Guiana - 18-5 mRNA SA | Metatranscriptome | Termitidae |
| 7 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 8 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 9 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 10 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 11 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 14 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 15 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 16 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 17 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 18 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 19 | 2940228231 | Anaerovoracaceae bacterium PM5-7 | Isolate | Blattidae |
| 20 | 8064531044 | Terrisporobacter mayombei DSM 6539 | Isolate | Unclassified |
| 21 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 22 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 23 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 24 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 25 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 26 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 27 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 28 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 29 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 30 | 2820314258 | Unclassified Firmicutes Nt197P4bin16 | Isolate | Unclassified |
| 31 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 32 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 33 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 34 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 35 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 36 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 37 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 38 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 39 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 40 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 41 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 42 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 43 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 44 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 45 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 46 | 2820324456 | Unclassified Firmicutes Nt197P3bin80 | Isolate | Unclassified |
| 47 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 48 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 49 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 50 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 51 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_342461 | 3300042612 | Bacteria | 4908 |
| 2 | JGI24705J35276_12064888 | 3300002504 | Bacteria | 942 |
| 3 | Ga0123357_10160657 | 3300009784 | Bacteria | 2694 |
| 4 | Ga0123356_10062470 | 3300010049 | Bacteria | 3479 |
| 5 | Ga0123356_10222594 | 3300010049 | Bacteria | 1945 |
| 6 | Ga0123356_11005580 | 3300010049 | Bacteria | 1004 |
| 7 | Ga0123353_10011361 | 3300010167 | Bacteria | 12538 |
| 8 | Ga0123353_11692001 | 3300010167 | Bacteria | 793 |
| 9 | Ga0123353_12866406 | 3300010167 | Bacteria | 563 |
| 10 | Ga0123354_10059695 | 3300010882 | Bacteria | 5653 |
| 11 | Ga0466715_211637 | 3300042616 | Bacteria | 14001 |
| 12 | Ga0466715_484303 | 3300042616 | Bacteria | 3194 |
| 13 | Ga0466703_424197 | 3300042636 | Bacteria | 2574 |
| 14 | Ga0466708_053951 | 3300042652 | Bacteria | 19818 |
| 15 | Ga0466708_079679 | 3300042652 | Bacteria | 41277 |
| 16 | Ga0466707_102772 | 3300042601 | Bacteria | 10357 |
| 17 | Ga0466719_528471 | 3300042606 | Bacteria | 3008 |
| 18 | Ga0466722_250136 | 3300042609 | Bacteria | 3071 |
| 19 | Ga0466694_016789 | 3300042594 | Bacteria | 1825 |
| 20 | Ga0466705_357809 | 3300042612 | Bacteria | 37083 |
| 21 | Ga0123355_10412747 | 3300009826 | Bacteria | 1732 |
| 22 | Ga0123355_10843462 | 3300009826 | Bacteria | 1010 |
| 23 | Ga0123356_12118695 | 3300010049 | Bacteria | 702 |
| 24 | Ga0466711_490508 | 3300042615 | Unclassified | 1808 |
| 25 | Ga0466715_298115 | 3300042616 | Bacteria | 5916 |
| 26 | Ga0466715_299474 | 3300042616 | Bacteria | 2433 |
| 27 | Ga0466723_151455 | 3300042618 | Unclassified | 1006 |
| 28 | Ga0466728_240430 | 3300042620 | Bacteria | 19472 |
| 29 | Ga0466734_057031 | 3300042623 | Bacteria | 1988 |
| 30 | Ga0466735_221921 | 3300042624 | Bacteria | 30703 |
| 31 | Ga0466703_242531 | 3300042636 | Bacteria | 1200 |
| 32 | Ga0466727_125041 | 3300042655 | Bacteria | 24880 |
| 33 | Ga0466727_173213 | 3300042655 | Bacteria | 5438 |
| 34 | Ga0466707_118478 | 3300042601 | Bacteria | 1064 |
| 35 | Ga0466707_406938 | 3300042601 | Bacteria | 47814 |
| 36 | Ga0466714_039083 | 3300042603 | Bacteria | 1647 |
| 37 | Ga0466657_120426 | 3300042582 | Bacteria | 1372 |
| 38 | Ga0466705_079320 | 3300042612 | Bacteria | 80574 |
| 39 | JGI24702J35022_10450207 | 3300002462 | Bacteria | 784 |
| 40 | JGI24705J35276_12238163 | 3300002504 | Bacteria | 16705 |
| 41 | Ga0123357_11033584 | 3300009784 | Bacteria | 505 |
| 42 | Ga0123355_10240916 | 3300009826 | Bacteria | 2562 |
| 43 | Ga0123356_10038571 | 3300010049 | Unclassified | 4452 |
| 44 | Ga0123356_10125678 | 3300010049 | Bacteria | 2503 |
| 45 | Ga0123353_10393816 | 3300010167 | Bacteria | 2065 |
| 46 | Ga0123353_13309926 | 3300010167 | Unclassified | 514 |
| 47 | Ga0466715_118668 | 3300042616 | Bacteria | 9572 |
| 48 | Ga0466715_393770 | 3300042616 | Bacteria | 24865 |
| 49 | Ga0466726_435536 | 3300042619 | Bacteria | 8048 |
| 50 | Ga0466729_213426 | 3300042621 | Bacteria | 1228 |
| 51 | Ga0466703_395127 | 3300042636 | Bacteria | 1561 |
| 52 | Ga0466704_255413 | 3300042643 | Bacteria | 1264 |
| 53 | Ga0466708_215601 | 3300042652 | Bacteria | 8054 |
| 54 | Ga0466713_008709 | 3300042602 | Bacteria | 25958 |
| 55 | Ga0466719_130446 | 3300042606 | Bacteria | 3854 |
| 56 | Ga0466719_347643 | 3300042606 | Bacteria | 8218 |
| 57 | Ga0466719_414102 | 3300042606 | Unclassified | 1141 |
| 58 | Ga0466696_331549 | 3300042596 | Unclassified | 1200 |
| 59 | Ga0068305_10726695 | 3300005083 | Bacteria | 823 |
| 60 | Ga0123356_12364806 | 3300010049 | Unclassified | 665 |
| 61 | Ga0123356_13029434 | 3300010049 | Bacteria | 586 |
| 62 | Ga0123353_10004749 | 3300010167 | Bacteria | 17612 |
| 63 | Ga0123353_10361729 | 3300010167 | Bacteria | 2180 |
| 64 | Ga0123353_10667545 | 3300010167 | Bacteria | 1467 |
| 65 | Ga0123353_11611908 | 3300010167 | Unclassified | 819 |
| 66 | Ga0123354_10201066 | 3300010882 | Bacteria | 2190 |
| 67 | Ga0466711_368768 | 3300042615 | Bacteria | 1772 |
| 68 | Ga0466715_599174 | 3300042616 | Bacteria | 1639 |
| 69 | Ga0466729_230538 | 3300042621 | Bacteria | 1392 |
| 70 | Ga0466704_617916 | 3300042643 | Bacteria | 3009 |
| 71 | Ga0466707_346442 | 3300042601 | Bacteria | 9195 |
| 72 | Ga0466713_019517 | 3300042602 | Bacteria | 68401 |
| 73 | Ga0466722_238982 | 3300042609 | Bacteria | 5314 |
| 74 | Ga0466732_444152 | 3300042656 | Bacteria | 1594 |
| 75 | JGI24705J35276_12164906 | 3300002504 | Bacteria | 1255 |
| 76 | Ga0068305_10059637 | 3300005083 | Bacteria | 5268 |
| 77 | Ga0072940_1453814 | 3300005200 | Bacteria | 810 |
| 78 | Ga0123355_10027091 | 3300009826 | Bacteria | 9253 |
| 79 | Ga0123353_10456446 | 3300010167 | Bacteria | 1879 |
| 80 | Ga0123353_10577277 | 3300010167 | Bacteria | 1614 |
| 81 | Ga0123353_10657873 | 3300010167 | Bacteria | 1481 |
| 82 | Ga0123353_11046961 | 3300010167 | Bacteria | 1090 |
| 83 | Ga0466723_024418 | 3300042618 | Bacteria | 7163 |
| 84 | Ga0466706_137786 | 3300042599 | Bacteria | 1193 |
| 85 | Ga0466707_164538 | 3300042601 | Bacteria | 30398 |
| 86 | Ga0466707_237976 | 3300042601 | Bacteria | 1633 |
| 87 | Ga0466713_020962 | 3300042602 | Bacteria | 8387 |
| 88 | Ga0466717_072789 | 3300042604 | Bacteria | 1042 |
| 89 | Ga0466722_252742 | 3300042609 | Bacteria | 2657 |
| 90 | Ga0223688_1002309 | 3300021227 | Bacteria | 6518 |
| 91 | Ga0466657_096055 | 3300042582 | Bacteria | 1165 |
| 92 | Ga0466691_188013 | 3300042593 | Bacteria | 6161 |
| 93 | Ga0466691_199512 | 3300042593 | Bacteria | 13089 |
| 94 | Ga0466705_135312 | 3300042612 | Bacteria | 2048 |
| 95 | JGI24702J35022_10004800 | 3300002462 | Bacteria | 7988 |
| 96 | Ga0123356_10122111 | 3300010049 | Bacteria | 2536 |
| 97 | Ga0123356_10639719 | 3300010049 | Bacteria | 1230 |
| 98 | Ga0123356_11324477 | 3300010049 | Bacteria | 883 |
| 99 | Ga0123356_11878184 | 3300010049 | Unclassified | 745 |
| 100 | Ga0123356_13162300 | 3300010049 | Bacteria | 573 |
| 101 | Ga0123356_13508725 | 3300010049 | Unclassified | 544 |
| 102 | Ga0123353_10064388 | 3300010167 | Bacteria | 5883 |
| 103 | Ga0123353_10124877 | 3300010167 | Bacteria | 4136 |
| 104 | Ga0123353_11530684 | 3300010167 | Bacteria | 847 |
| 105 | Ga0466711_073040 | 3300042615 | Unclassified | 1795 |
| 106 | Ga0466723_336467 | 3300042618 | Bacteria | 1850 |
| 107 | Ga0466734_032846 | 3300042623 | Bacteria | 1163 |
| 108 | Ga0466703_375570 | 3300042636 | Bacteria | 1490 |
| 109 | Ga0466725_109431 | 3300042654 | Bacteria | 1952 |
| 110 | Ga0466700_127609 | 3300042600 | Bacteria | 1820 |
| 111 | Ga0466717_125060 | 3300042604 | Bacteria | 2040 |
| 112 | Ga0223688_1007544 | 3300021227 | Bacteria | 525 |
| 113 | Ga0466692_151313 | 3300042591 | Bacteria | 9518 |
| 114 | Ga0123356_10011738 | 3300010049 | Bacteria | 8528 |
| 115 | Ga0123356_10031620 | 3300010049 | Bacteria | 4952 |
| 116 | Ga0123356_11720832 | 3300010049 | Bacteria | 778 |
| 117 | Ga0123353_10579676 | 3300010167 | Bacteria | 1610 |
| 118 | Ga0123353_10686489 | 3300010167 | Bacteria | 1441 |
| 119 | Ga0123354_10254821 | 3300010882 | Bacteria | 1768 |
| 120 | Ga0123354_10541413 | 3300010882 | Unclassified | 883 |
| 121 | Ga0466711_259889 | 3300042615 | Bacteria | 3347 |
| 122 | Ga0466728_002062 | 3300042620 | Unclassified | 2345 |
| 123 | Ga0466709_014700 | 3300042648 | Bacteria | 1762 |
| 124 | Ga0466701_070960 | 3300042598 | Bacteria | 4469 |
| 125 | Ga0466713_128565 | 3300042602 | Bacteria | 50941 |
| 126 | Ga0466722_072253 | 3300042609 | Bacteria | 3358 |
| 127 | Ga0466696_066447 | 3300042596 | Bacteria | 5902 |
| 128 | Ga0466696_283703 | 3300042596 | Bacteria | 19581 |
| 129 | Ga0466696_359722 | 3300042596 | Bacteria | 2646 |
| 130 | Ga0466696_390265 | 3300042596 | Bacteria | 1039 |
| 131 | Ga0466733_164265 | 3300042659 | Bacteria | 2529 |
| 132 | JGI24702J35022_10017033 | 3300002462 | Bacteria | 3977 |
| 133 | JGI24696J40584_12889132 | 3300002834 | Bacteria | 1121 |
| 134 | Ga0123353_10316373 | 3300010167 | Bacteria | 2371 |
| 135 | Ga0123353_10410512 | 3300010167 | Bacteria | 2011 |
| 136 | Ga0123353_11305964 | 3300010167 | Bacteria | 941 |
| 137 | Ga0466726_387933 | 3300042619 | Bacteria | 1447 |
| 138 | Ga0466728_082463 | 3300042620 | Bacteria | 32980 |
| 139 | Ga0466729_250043 | 3300042621 | Bacteria | 6259 |
| 140 | Ga0466731_423403 | 3300042622 | Bacteria | 1745 |
| 141 | Ga0466734_122793 | 3300042623 | Bacteria | 1337 |
| 142 | Ga0466702_050921 | 3300042635 | Bacteria | 1098 |
| 143 | Ga0466704_031146 | 3300042643 | Bacteria | 38318 |
| 144 | Ga0466709_217396 | 3300042648 | Bacteria | 210619 |
| 145 | Ga0466722_173467 | 3300042609 | Bacteria | 3100 |
| 146 | Ga0466692_130735 | 3300042591 | Bacteria | 26218 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00366 | Ribosomal_S17 | Ribosomal protein S17 | 30 | 96 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.