Protein Family IF08343
Metagenome
Isolate
166
Members
41
Samples
164
Scaffolds
112.05
Avg Length
Representative Sequence
- ID
- 3300042619|Ga0466726_412538|Ga0466726_412538_638_973
- Length
- 111 aa
- Sequence
- MMSYKGYTAFVEFDTEAKIFHGEVADLSDVVTFQNTDAEQLEEEFHQSVDVYLTFCQETGRQPEKPFSGKFIVRIPKQLHQKAFLTAQHRKQSLNSFIARAIEKEVHALSE
Sample Types
Isolate
1.2%
Metagenome
98.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
74.4%
Unclassified
10.3%
Kalotermitidae
5.1%
Termopsidae
5.1%
Rhinotermitidae
2.6%
Hodotermitidae
2.6%
Taxonomy
Archaea
0
Bacteria
94
Eukaryota
0
Viruses
0
Unclassified
72
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 6 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 7 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 8 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 9 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 10 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 11 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 12 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 13 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 14 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 15 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 16 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 17 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 18 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 19 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 20 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 21 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 22 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 23 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 24 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 25 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 26 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 27 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 28 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 29 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 30 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 31 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 32 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 33 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 34 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 35 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 36 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 37 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 38 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 39 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 40 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 41 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466712_000406 | 3300042614 | Unclassified | 2133 |
| 2 | Ga0466712_031459 | 3300042614 | Unclassified | 2719 |
| 3 | Ga0466712_118596 | 3300042614 | Bacteria | 4814 |
| 4 | Ga0466712_130536 | 3300042614 | Unclassified | 2233 |
| 5 | Ga0466731_094165 | 3300042622 | Bacteria | 1464 |
| 6 | Ga0466694_013239 | 3300042594 | Unclassified | 1423 |
| 7 | Ga0466694_146969 | 3300042594 | Bacteria | 18139 |
| 8 | Ga0466699_032065 | 3300042597 | Bacteria | 10099 |
| 9 | Ga0466699_296718 | 3300042597 | Bacteria | 3730 |
| 10 | Ga0466699_323693 | 3300042597 | Unclassified | 1173 |
| 11 | Ga0466706_283562 | 3300042599 | Bacteria | 1143 |
| 12 | Ga0466700_250618 | 3300042600 | Bacteria | 1371 |
| 13 | Ga0123355_10464167 | 3300009826 | Bacteria | 1587 |
| 14 | Ga0123355_12181489 | 3300009826 | Unclassified | 507 |
| 15 | Ga0123356_12291950 | 3300010049 | Bacteria | 675 |
| 16 | Ga0123353_11289367 | 3300010167 | Unclassified | 949 |
| 17 | Ga0123353_12547633 | 3300010167 | Unclassified | 607 |
| 18 | AustNasuHG_c1019154 | 3300000089 | Unclassified | 2250 |
| 19 | AustNasuHG_c1037179 | 3300000089 | Unclassified | 1249 |
| 20 | JGI24698J34947_10002253 | 3300002449 | Bacteria | 10330 |
| 21 | JGI24698J34947_10035370 | 3300002449 | Bacteria | 2607 |
| 22 | JGI24698J34947_10044008 | 3300002449 | Bacteria | 2286 |
| 23 | JGI24698J34947_10275674 | 3300002449 | Unclassified | 617 |
| 24 | JGI24695J34938_10022997 | 3300002450 | Bacteria | 3013 |
| 25 | JGI24695J34938_10217868 | 3300002450 | Unclassified | 800 |
| 26 | JGI24699J35502_10887598 | 3300002509 | Bacteria | 1021 |
| 27 | Ga0072941_1012847 | 3300005201 | Bacteria | 9378 |
| 28 | Ga0466733_101477 | 3300042659 | Bacteria | 12876 |
| 29 | Ga0466712_165291 | 3300042614 | Bacteria | 1241 |
| 30 | Ga0466712_232046 | 3300042614 | Bacteria | 14530 |
| 31 | Ga0466731_378598 | 3300042622 | Unclassified | 1214 |
| 32 | Ga0466702_288770 | 3300042635 | Bacteria | 1698 |
| 33 | Ga0466699_038449 | 3300042597 | Bacteria | 21872 |
| 34 | Ga0466699_340785 | 3300042597 | Unclassified | 2799 |
| 35 | Ga0123356_10157166 | 3300010049 | Bacteria | 2266 |
| 36 | Ga0123353_10765085 | 3300010167 | Bacteria | 1341 |
| 37 | Ga0123354_10587368 | 3300010882 | Unclassified | 822 |
| 38 | AustNasuHG_c1001503 | 3300000089 | Bacteria | 8365 |
| 39 | JGI24698J34947_10067888 | 3300002449 | Unclassified | 1727 |
| 40 | JGI24698J34947_10132836 | 3300002449 | Bacteria | 1061 |
| 41 | JGI24698J34947_10158372 | 3300002449 | Unclassified | 931 |
| 42 | JGI24698J34947_10219997 | 3300002449 | Bacteria | 729 |
| 43 | JGI24702J35022_10186631 | 3300002462 | Bacteria | 1181 |
| 44 | Ga0466712_002564 | 3300042614 | Unclassified | 2530 |
| 45 | Ga0466712_071806 | 3300042614 | Bacteria | 4943 |
| 46 | Ga0466712_106136 | 3300042614 | Bacteria | 3400 |
| 47 | Ga0466712_230766 | 3300042614 | Unclassified | 8053 |
| 48 | Ga0466718_074586 | 3300042617 | Bacteria | 1198 |
| 49 | Ga0466699_193460 | 3300042597 | Bacteria | 1664 |
| 50 | Ga0123353_10967202 | 3300010167 | Unclassified | 1149 |
| 51 | JGI24698J34947_10018619 | 3300002449 | Bacteria | 3749 |
| 52 | JGI24698J34947_10192677 | 3300002449 | Unclassified | 805 |
| 53 | JGI24695J34938_10578876 | 3300002450 | Unclassified | 521 |
| 54 | JGI24702J35022_10003897 | 3300002462 | Bacteria | 8949 |
| 55 | JGI24702J35022_10070315 | 3300002462 | Bacteria | 1884 |
| 56 | JGI24705J35276_12215685 | 3300002504 | Unclassified | 2012 |
| 57 | JGI24699J35502_10950417 | 3300002509 | Unclassified | 1171 |
| 58 | Ga0072940_1229294 | 3300005200 | Bacteria | 906 |
| 59 | Ga0466712_001714 | 3300042614 | Unclassified | 1006 |
| 60 | Ga0466712_025900 | 3300042614 | Bacteria | 38213 |
| 61 | Ga0466712_155058 | 3300042614 | Bacteria | 14937 |
| 62 | Ga0466712_172370 | 3300042614 | Bacteria | 4754 |
| 63 | Ga0466712_242085 | 3300042614 | Unclassified | 1177 |
| 64 | Ga0466711_054448 | 3300042615 | Bacteria | 3077 |
| 65 | Ga0466702_037833 | 3300042635 | Unclassified | 1356 |
| 66 | Ga0466703_103104 | 3300042636 | Bacteria | 11114 |
| 67 | Ga0466703_231279 | 3300042636 | Bacteria | 1862 |
| 68 | Ga0264413_108354 | 3300024493 | Bacteria | 8156 |
| 69 | Ga0415639_016654 | 3300038395 | Bacteria | 1520 |
| 70 | Ga0466699_053056 | 3300042597 | Unclassified | 1001 |
| 71 | Ga0466699_335971 | 3300042597 | Bacteria | 1915 |
| 72 | Ga0466721_026567 | 3300042608 | Unclassified | 1577 |
| 73 | Ga0466721_202594 | 3300042608 | Bacteria | 33171 |
| 74 | Ga0466698_330418 | 3300042610 | Bacteria | 1134 |
| 75 | Ga0123356_10016274 | 3300010049 | Bacteria | 7101 |
| 76 | Ga0123356_10228815 | 3300010049 | Bacteria | 1922 |
| 77 | Ga0123356_10604420 | 3300010049 | Unclassified | 1261 |
| 78 | Ga0123356_12192645 | 3300010049 | Unclassified | 690 |
| 79 | Ga0123356_12621539 | 3300010049 | Unclassified | 631 |
| 80 | AustNasuHG_c1000409 | 3300000089 | Bacteria | 14884 |
| 81 | JGI24698J34947_10023259 | 3300002449 | Bacteria | 3316 |
| 82 | Ga0466732_034159 | 3300042656 | Bacteria | 2608 |
| 83 | Ga0466712_042115 | 3300042614 | Unclassified | 7657 |
| 84 | Ga0466712_064541 | 3300042614 | Unclassified | 6986 |
| 85 | Ga0466712_161213 | 3300042614 | Unclassified | 1629 |
| 86 | Ga0466712_179723 | 3300042614 | Unclassified | 1477 |
| 87 | Ga0466712_190419 | 3300042614 | Unclassified | 1571 |
| 88 | Ga0466711_480242 | 3300042615 | Bacteria | 1220 |
| 89 | Ga0466718_072042 | 3300042617 | Bacteria | 1043 |
| 90 | Ga0466695_178889 | 3300042595 | Bacteria | 70582 |
| 91 | Ga0466698_129058 | 3300042610 | Unclassified | 1220 |
| 92 | Ga0466698_443476 | 3300042610 | Unclassified | 1531 |
| 93 | Ga0123356_10000339 | 3300010049 | Bacteria | 53899 |
| 94 | Ga0123356_10000505 | 3300010049 | Bacteria | 43649 |
| 95 | Ga0123356_10015484 | 3300010049 | Bacteria | 7308 |
| 96 | Ga0123356_10527114 | 3300010049 | Unclassified | 1340 |
| 97 | Ga0123356_13968695 | 3300010049 | Unclassified | 510 |
| 98 | Ga0123353_10213191 | 3300010167 | Bacteria | 3027 |
| 99 | Ga0123353_11791417 | 3300010167 | Bacteria | 763 |
| 100 | AustNasuHG_c1081617 | 3300000089 | Unclassified | 545 |
| 101 | JGI24698J34947_10110664 | 3300002449 | Bacteria | 1213 |
| 102 | JGI24698J34947_10231253 | 3300002449 | Unclassified | 702 |
| 103 | JGI24695J34938_10333413 | 3300002450 | Unclassified | 663 |
| 104 | JGI24702J35022_10153799 | 3300002462 | Unclassified | 1292 |
| 105 | JGI24705J35276_11953712 | 3300002504 | Unclassified | 798 |
| 106 | Ga0466712_158492 | 3300042614 | Unclassified | 1387 |
| 107 | Ga0466712_192211 | 3300042614 | Unclassified | 12731 |
| 108 | Ga0466711_027987 | 3300042615 | Bacteria | 1840 |
| 109 | Ga0466693_262743 | 3300042592 | Unclassified | 1267 |
| 110 | Ga0466694_143224 | 3300042594 | Bacteria | 7681 |
| 111 | Ga0466694_306205 | 3300042594 | Bacteria | 1174 |
| 112 | Ga0466695_387244 | 3300042595 | Bacteria | 2295 |
| 113 | Ga0466699_051695 | 3300042597 | Unclassified | 1580 |
| 114 | Ga0466699_345180 | 3300042597 | Bacteria | 4208 |
| 115 | Ga0466707_324048 | 3300042601 | Bacteria | 6639 |
| 116 | Ga0123353_11674661 | 3300010167 | Bacteria | 798 |
| 117 | Ga0123354_10529932 | 3300010882 | Unclassified | 900 |
| 118 | Ga0123354_10747255 | 3300010882 | Unclassified | 671 |
| 119 | AustNasuHG_c1082236 | 3300000089 | Bacteria | 541 |
| 120 | JGI24698J34947_10000583 | 3300002449 | Unclassified | 17389 |
| 121 | JGI24698J34947_10006149 | 3300002449 | Bacteria | 6593 |
| 122 | JGI24698J34947_10035997 | 3300002449 | Unclassified | 2579 |
| 123 | JGI24698J34947_10064468 | 3300002449 | Bacteria | 1791 |
| 124 | JGI24698J34947_10082715 | 3300002449 | Unclassified | 1500 |
| 125 | JGI24698J34947_10198888 | 3300002449 | Unclassified | 786 |
| 126 | JGI24702J35022_10025398 | 3300002462 | Unclassified | 3197 |
| 127 | JGI24699J35502_11125679 | 3300002509 | Bacteria | 3836 |
| 128 | Ga0466712_123058 | 3300042614 | Unclassified | 3533 |
| 129 | Ga0466712_149364 | 3300042614 | Bacteria | 12500 |
| 130 | Ga0466712_248065 | 3300042614 | Bacteria | 10133 |
| 131 | Ga0466718_109459 | 3300042617 | Unclassified | 1189 |
| 132 | Ga0466729_310473 | 3300042621 | Unclassified | 1782 |
| 133 | Ga0466699_056016 | 3300042597 | Unclassified | 1843 |
| 134 | Ga0466699_112239 | 3300042597 | Bacteria | 1114 |
| 135 | Ga0466699_289847 | 3300042597 | Bacteria | 2475 |
| 136 | Ga0123357_10528856 | 3300009784 | Unclassified | 957 |
| 137 | Ga0123356_10080668 | 3300010049 | Bacteria | 3077 |
| 138 | AustNasuHG_c1003081 | 3300000089 | Bacteria | 6015 |
| 139 | JGI24698J34947_10008488 | 3300002449 | Bacteria | 5638 |
| 140 | JGI24698J34947_10015988 | 3300002449 | Bacteria | 4080 |
| 141 | JGI24698J34947_10036733 | 3300002449 | Unclassified | 2549 |
| 142 | JGI24698J34947_10138319 | 3300002449 | Unclassified | 1030 |
| 143 | JGI24698J34947_10186327 | 3300002449 | Unclassified | 825 |
| 144 | JGI24695J34938_10239443 | 3300002450 | Bacteria | 767 |
| 145 | JGI24702J35022_10227329 | 3300002462 | Unclassified | 1078 |
| 146 | Ga0466712_001797 | 3300042614 | Unclassified | 3379 |
| 147 | Ga0466712_314447 | 3300042614 | Unclassified | 3870 |
| 148 | Ga0466718_083581 | 3300042617 | Bacteria | 2373 |
| 149 | Ga0466726_412538 | 3300042619 | Bacteria | 1498 |
| 150 | Ga0466735_199700 | 3300042624 | Bacteria | 15874 |
| 151 | Ga0466730_043133 | 3300042625 | Unclassified | 2166 |
| 152 | Ga0466702_167471 | 3300042635 | Bacteria | 2713 |
| 153 | Ga0466699_402795 | 3300042597 | Unclassified | 1260 |
| 154 | Ga0466713_142363 | 3300042602 | Bacteria | 2283 |
| 155 | Ga0466717_262107 | 3300042604 | Bacteria | 2102 |
| 156 | Ga0123356_10121259 | 3300010049 | Bacteria | 2543 |
| 157 | Ga0123353_11248980 | 3300010167 | Unclassified | 970 |
| 158 | Ga0123353_11469306 | 3300010167 | Unclassified | 871 |
| 159 | JGI24698J34947_10008040 | 3300002449 | Bacteria | 5791 |
| 160 | JGI24698J34947_10172382 | 3300002449 | Bacteria | 874 |
| 161 | JGI24702J35022_10101600 | 3300002462 | Bacteria | 1575 |
| 162 | JGI24702J35022_10448765 | 3300002462 | Bacteria | 785 |
| 163 | JGI24696J40584_12912212 | 3300002834 | Bacteria | 1266 |
| 164 | Ga0072941_1016269 | 3300005201 | Bacteria | 40017 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042604 | Ga0466717_262107 | Ga0466717_262107_357_659 | 100 |
| 2 | 3300042656 | Ga0466732_034159 | Ga0466732_034159_31_348 | 105 |
| 3 | 3300042608 | Ga0466721_202594 | Ga0466721_202594_341_670 | 109 |
| 4 | 3300042624 | Ga0466735_199700 | Ga0466735_199700_2384_2713 | 109 |
| 5 | 3300010049 | Ga0123356_12192645 | Ga0123356_121926452 | 110 |
| 6 | 3300042594 | Ga0466694_143224 | Ga0466694_143224_6473_6805 | 110 |
| 7 | 3300042595 | Ga0466695_387244 | Ga0466695_387244_975_1307 | 110 |
| 8 | 3300042597 | Ga0466699_032065 | Ga0466699_032065_8123_8455 | 110 |
| 9 | 3300042597 | Ga0466699_038449 | Ga0466699_038449_21120_21452 | 110 |
| 10 | 3300042597 | Ga0466699_051695 | Ga0466699_051695_573_905 | 110 |
| 11 | 3300042597 | Ga0466699_053056 | Ga0466699_053056_411_743 | 110 |
| 12 | 3300042597 | Ga0466699_112239 | Ga0466699_112239_184_516 | 110 |
| 13 | 3300042597 | Ga0466699_296718 | Ga0466699_296718_650_982 | 110 |
| 14 | 3300042597 | Ga0466699_323693 | Ga0466699_323693_734_1066 | 110 |
| 15 | 3300042597 | Ga0466699_335971 | Ga0466699_335971_1203_1535 | 110 |
| 16 | 3300042597 | Ga0466699_340785 | Ga0466699_340785_671_1003 | 110 |
| 17 | 3300042597 | Ga0466699_345180 | Ga0466699_345180_627_959 | 110 |
| 18 | 3300042597 | Ga0466699_402795 | Ga0466699_402795_827_1159 | 110 |
| 19 | 3300042599 | Ga0466706_283562 | Ga0466706_283562_357_689 | 110 |
| 20 | 3300042600 | Ga0466700_250618 | Ga0466700_250618_214_546 | 110 |
| 21 | 3300042610 | Ga0466698_129058 | Ga0466698_129058_215_547 | 110 |
| 22 | 3300042614 | Ga0466712_149364 | Ga0466712_149364_2404_2736 | 110 |
| 23 | 3300042614 | Ga0466712_155058 | Ga0466712_155058_3506_3838 | 110 |
| 24 | 3300042614 | Ga0466712_165291 | Ga0466712_165291_846_1178 | 110 |
| 25 | 3300042614 | Ga0466712_190419 | Ga0466712_190419_554_886 | 110 |
| 26 | 3300042615 | Ga0466711_027987 | Ga0466711_027987_714_1046 | 110 |
| 27 | 3300042615 | Ga0466711_054448 | Ga0466711_054448_299_631 | 110 |
| 28 | 3300042617 | Ga0466718_072042 | Ga0466718_072042_285_617 | 110 |
| 29 | 3300042617 | Ga0466718_074586 | Ga0466718_074586_237_569 | 110 |
| 30 | 3300042617 | Ga0466718_083581 | Ga0466718_083581_1580_1912 | 110 |
| 31 | 3300042636 | Ga0466703_103104 | Ga0466703_103104_403_735 | 110 |
| 32 | 3300042636 | Ga0466703_231279 | Ga0466703_231279_1191_1523 | 110 |
| 33 | 3300002449 | JGI24698J34947_10006149 | JGI24698J34947_100061492 | 111 |
| 34 | 3300002449 | JGI24698J34947_10044008 | JGI24698J34947_100440083 | 111 |
| 35 | 3300009784 | Ga0123357_10528856 | Ga0123357_105288562 | 111 |
| 36 | 3300010167 | Ga0123353_11469306 | Ga0123353_114693061 | 111 |
| 37 | 3300024493 | Ga0264413_108354 | Ga0264413_1083543 | 111 |
| 38 | 3300042594 | Ga0466694_146969 | Ga0466694_146969_4092_4427 | 111 |
| 39 | 3300042594 | Ga0466694_306205 | Ga0466694_306205_792_1127 | 111 |
| 40 | 3300042597 | Ga0466699_056016 | Ga0466699_056016_190_525 | 111 |
| 41 | 3300042597 | Ga0466699_289847 | Ga0466699_289847_1587_1922 | 111 |
| 42 | 3300042601 | Ga0466707_324048 | Ga0466707_324048_5258_5593 | 111 |
| 43 | 3300042610 | Ga0466698_330418 | Ga0466698_330418_103_438 | 111 |
| 44 | 3300042610 | Ga0466698_443476 | Ga0466698_443476_213_548 | 111 |
| 45 | 3300042614 | Ga0466712_001714 | Ga0466712_001714_207_542 | 111 |
| 46 | 3300042614 | Ga0466712_001797 | Ga0466712_001797_1663_1998 | 111 |
| 47 | 3300042614 | Ga0466712_002564 | Ga0466712_002564_1267_1602 | 111 |
| 48 | 3300042614 | Ga0466712_118596 | Ga0466712_118596_4454_4789 | 111 |
| 49 | 3300042614 | Ga0466712_123058 | Ga0466712_123058_2928_3263 | 111 |
| 50 | 3300042614 | Ga0466712_158492 | Ga0466712_158492_1010_1345 | 111 |
| 51 | 3300042614 | Ga0466712_172370 | Ga0466712_172370_911_1246 | 111 |
| 52 | 3300042614 | Ga0466712_179723 | Ga0466712_179723_61_396 | 111 |
| 53 | 3300042614 | Ga0466712_192211 | Ga0466712_192211_1708_2043 | 111 |
| 54 | 3300042614 | Ga0466712_230766 | Ga0466712_230766_3340_3675 | 111 |
| 55 | 3300042614 | Ga0466712_248065 | Ga0466712_248065_694_1029 | 111 |
| 56 | 3300042614 | Ga0466712_314447 | Ga0466712_314447_894_1229 | 111 |
| 57 | 3300042615 | Ga0466711_480242 | Ga0466711_480242_712_1047 | 111 |
| 58 | 3300042617 | Ga0466718_109459 | Ga0466718_109459_412_747 | 111 |
| 59 | 3300042619 | Ga0466726_412538 | Ga0466726_412538_638_973 | 111 |
| 60 | 3300042625 | Ga0466730_043133 | Ga0466730_043133_1638_1973 | 111 |
| 61 | 3300042635 | Ga0466702_037833 | Ga0466702_037833_410_745 | 111 |
| 62 | 3300042635 | Ga0466702_167471 | Ga0466702_167471_1556_1891 | 111 |
| 63 | 3300042659 | Ga0466733_101477 | Ga0466733_101477_5179_5514 | 111 |
| 64 | 3300000089 | AustNasuHG_c1000409 | AustNasuHG_10004092 | 112 |
| 65 | 3300000089 | AustNasuHG_c1001503 | AustNasuHG_10015039 | 112 |
| 66 | 3300002449 | JGI24698J34947_10002253 | JGI24698J34947_100022539 | 112 |
| 67 | 3300002449 | JGI24698J34947_10035997 | JGI24698J34947_100359972 | 112 |
| 68 | 3300002449 | JGI24698J34947_10036733 | JGI24698J34947_100367331 | 112 |
| 69 | 3300002449 | JGI24698J34947_10110664 | JGI24698J34947_101106642 | 112 |
| 70 | 3300002449 | JGI24698J34947_10158372 | JGI24698J34947_101583722 | 112 |
| 71 | 3300002449 | JGI24698J34947_10198888 | JGI24698J34947_101988882 | 112 |
| 72 | 3300002450 | JGI24695J34938_10333413 | JGI24695J34938_103334131 | 112 |
| 73 | 3300002462 | JGI24702J35022_10101600 | JGI24702J35022_101016003 | 112 |
| 74 | 3300002462 | JGI24702J35022_10153799 | JGI24702J35022_101537993 | 112 |
| 75 | 3300002462 | JGI24702J35022_10227329 | JGI24702J35022_102273292 | 112 |
| 76 | 3300002504 | JGI24705J35276_11953712 | JGI24705J35276_119537123 | 112 |
| 77 | 3300002834 | JGI24696J40584_12912212 | JGI24696J40584_129122122 | 112 |
| 78 | 3300005200 | Ga0072940_1229294 | Ga0072940_12292943 | 112 |
| 79 | 3300010049 | Ga0123356_10080668 | Ga0123356_100806682 | 112 |
| 80 | 3300010049 | Ga0123356_10157166 | Ga0123356_101571666 | 112 |
| 81 | 3300010049 | Ga0123356_12621539 | Ga0123356_126215391 | 112 |
| 82 | 3300010049 | Ga0123356_13968695 | Ga0123356_139686952 | 112 |
| 83 | 3300010882 | Ga0123354_10529932 | Ga0123354_105299322 | 112 |
| 84 | 3300010882 | Ga0123354_10747255 | Ga0123354_107472552 | 112 |
| 85 | 3300038395 | Ga0415639_016654 | Ga0415639_016654_1127_1465 | 112 |
| 86 | 3300042594 | Ga0466694_013239 | Ga0466694_013239_549_887 | 112 |
| 87 | 3300042595 | Ga0466695_178889 | Ga0466695_178889_60362_60700 | 112 |
| 88 | 3300042597 | Ga0466699_193460 | Ga0466699_193460_342_680 | 112 |
| 89 | 3300042608 | Ga0466721_026567 | Ga0466721_026567_1100_1438 | 112 |
| 90 | 3300042614 | Ga0466712_000406 | Ga0466712_000406_1286_1624 | 112 |
| 91 | 3300042614 | Ga0466712_031459 | Ga0466712_031459_132_470 | 112 |
| 92 | 3300042614 | Ga0466712_042115 | Ga0466712_042115_4863_5201 | 112 |
| 93 | 3300042614 | Ga0466712_064541 | Ga0466712_064541_3710_4048 | 112 |
| 94 | 3300042614 | Ga0466712_071806 | Ga0466712_071806_623_961 | 112 |
| 95 | 3300042614 | Ga0466712_106136 | Ga0466712_106136_2969_3307 | 112 |
| 96 | 3300042614 | Ga0466712_130536 | Ga0466712_130536_571_909 | 112 |
| 97 | 3300042614 | Ga0466712_161213 | Ga0466712_161213_960_1298 | 112 |
| 98 | 3300042614 | Ga0466712_232046 | Ga0466712_232046_14144_14482 | 112 |
| 99 | 3300042614 | Ga0466712_242085 | Ga0466712_242085_592_930 | 112 |
| 100 | 3300042621 | Ga0466729_310473 | Ga0466729_310473_241_579 | 112 |
| 101 | 3300002449 | JGI24698J34947_10000583 | JGI24698J34947_100005835 | 113 |
| 102 | 3300002449 | JGI24698J34947_10008040 | JGI24698J34947_100080406 | 113 |
| 103 | 3300002449 | JGI24698J34947_10008488 | JGI24698J34947_100084884 | 113 |
| 104 | 3300002449 | JGI24698J34947_10018619 | JGI24698J34947_100186194 | 113 |
| 105 | 3300002449 | JGI24698J34947_10023259 | JGI24698J34947_100232591 | 113 |
| 106 | 3300002449 | JGI24698J34947_10035370 | JGI24698J34947_100353701 | 113 |
| 107 | 3300002449 | JGI24698J34947_10064468 | JGI24698J34947_100644682 | 113 |
| 108 | 3300002449 | JGI24698J34947_10082715 | JGI24698J34947_100827152 | 113 |
| 109 | 3300002449 | JGI24698J34947_10172382 | JGI24698J34947_101723821 | 113 |
| 110 | 3300002449 | JGI24698J34947_10186327 | JGI24698J34947_101863272 | 113 |
| 111 | 3300002449 | JGI24698J34947_10192677 | JGI24698J34947_101926771 | 113 |
| 112 | 3300002449 | JGI24698J34947_10219997 | JGI24698J34947_102199971 | 113 |
| 113 | 3300002449 | JGI24698J34947_10231253 | JGI24698J34947_102312532 | 113 |
| 114 | 3300002449 | JGI24698J34947_10275674 | JGI24698J34947_102756742 | 113 |
| 115 | 3300002450 | JGI24695J34938_10022997 | JGI24695J34938_100229973 | 113 |
| 116 | 3300002462 | JGI24702J35022_10070315 | JGI24702J35022_100703153 | 113 |
| 117 | 3300002462 | JGI24702J35022_10186631 | JGI24702J35022_101866311 | 113 |
| 118 | 3300002509 | JGI24699J35502_10887598 | JGI24699J35502_108875982 | 113 |
| 119 | 3300002509 | JGI24699J35502_10950417 | JGI24699J35502_109504172 | 113 |
| 120 | 3300009826 | Ga0123355_10464167 | Ga0123355_104641672 | 113 |
| 121 | 3300010049 | Ga0123356_10015484 | Ga0123356_1001548410 | 113 |
| 122 | 3300010049 | Ga0123356_10527114 | Ga0123356_105271141 | 113 |
| 123 | 3300010049 | Ga0123356_12291950 | Ga0123356_122919501 | 113 |
| 124 | 3300010167 | Ga0123353_10213191 | Ga0123353_102131912 | 113 |
| 125 | 3300010167 | Ga0123353_10967202 | Ga0123353_109672021 | 113 |
| 126 | 3300010167 | Ga0123353_11289367 | Ga0123353_112893671 | 113 |
| 127 | 3300010167 | Ga0123353_11791417 | Ga0123353_117914172 | 113 |
| 128 | 3300010167 | Ga0123353_12547633 | Ga0123353_125476331 | 113 |
| 129 | 3300042592 | Ga0466693_262743 | Ga0466693_262743_599_940 | 113 |
| 130 | 3300042622 | Ga0466731_378598 | Ga0466731_378598_523_864 | 113 |
| 131 | iso_pr_bacteria | 2781125658 | 2781324759 | 113 |
| 132 | iso_pr_bacteria | 2781125696 | 2781440257 | 113 |
| 133 | 3300000089 | AustNasuHG_c1003081 | AustNasuHG_10030812 | 114 |
| 134 | 3300000089 | AustNasuHG_c1019154 | AustNasuHG_10191542 | 114 |
| 135 | 3300000089 | AustNasuHG_c1037179 | AustNasuHG_10371794 | 114 |
| 136 | 3300000089 | AustNasuHG_c1081617 | AustNasuHG_10816172 | 114 |
| 137 | 3300002449 | JGI24698J34947_10015988 | JGI24698J34947_100159882 | 114 |
| 138 | 3300002449 | JGI24698J34947_10067888 | JGI24698J34947_100678882 | 114 |
| 139 | 3300002450 | JGI24695J34938_10217868 | JGI24695J34938_102178681 | 114 |
| 140 | 3300002450 | JGI24695J34938_10239443 | JGI24695J34938_102394431 | 114 |
| 141 | 3300002450 | JGI24695J34938_10578876 | JGI24695J34938_105788761 | 114 |
| 142 | 3300002462 | JGI24702J35022_10003897 | JGI24702J35022_100038975 | 114 |
| 143 | 3300002462 | JGI24702J35022_10448765 | JGI24702J35022_104487652 | 114 |
| 144 | 3300002504 | JGI24705J35276_12215685 | JGI24705J35276_122156852 | 114 |
| 145 | 3300002509 | JGI24699J35502_11125679 | JGI24699J35502_111256793 | 114 |
| 146 | 3300005201 | Ga0072941_1012847 | Ga0072941_10128479 | 114 |
| 147 | 3300009826 | Ga0123355_12181489 | Ga0123355_121814891 | 114 |
| 148 | 3300010049 | Ga0123356_10000339 | Ga0123356_1000033934 | 114 |
| 149 | 3300010049 | Ga0123356_10000505 | Ga0123356_1000050529 | 114 |
| 150 | 3300010049 | Ga0123356_10121259 | Ga0123356_101212593 | 114 |
| 151 | 3300010049 | Ga0123356_10228815 | Ga0123356_102288152 | 114 |
| 152 | 3300010049 | Ga0123356_10604420 | Ga0123356_106044202 | 114 |
| 153 | 3300010167 | Ga0123353_10765085 | Ga0123353_107650853 | 114 |
| 154 | 3300010167 | Ga0123353_11248980 | Ga0123353_112489802 | 114 |
| 155 | 3300010167 | Ga0123353_11674661 | Ga0123353_116746611 | 114 |
| 156 | 3300042602 | Ga0466713_142363 | Ga0466713_142363_454_798 | 114 |
| 157 | 3300042622 | Ga0466731_094165 | Ga0466731_094165_308_652 | 114 |
| 158 | 3300042635 | Ga0466702_288770 | Ga0466702_288770_502_846 | 114 |
| 159 | 3300000089 | AustNasuHG_c1082236 | AustNasuHG_10822362 | 115 |
| 160 | 3300002462 | JGI24702J35022_10025398 | JGI24702J35022_100253984 | 115 |
| 161 | 3300005201 | Ga0072941_1016269 | Ga0072941_101626935 | 115 |
| 162 | 3300002449 | JGI24698J34947_10132836 | JGI24698J34947_101328361 | 116 |
| 163 | 3300002449 | JGI24698J34947_10138319 | JGI24698J34947_101383193 | 116 |
| 164 | 3300010882 | Ga0123354_10587368 | Ga0123354_105873681 | 117 |
| 165 | 3300042614 | Ga0466712_025900 | Ga0466712_025900_1791_2147 | 118 |
| 166 | 3300010049 | Ga0123356_10016274 | Ga0123356_100162743 | 121 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF05534 | HicB | HicB family | 52 | 102 | 0.98 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.64 | 0.76 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.