Protein Family IF08266

Metagenome Isolate
160 Members
83 Samples
113 Scaffolds
429.94 Avg Length

🧬 Representative Sequence

ID
3300042619|Ga0466726_224822|Ga0466726_224822_83_1612
Length
509 aa
Sequence
MTEPLHSDSNTVIVDVRTTEEFFGGHIDKSVNIPLEKIVSSVENLKKYDNIIIVCASGKRSAQAKSILEGEGLKNVHDGGGCQNFYETQQIIALIKREVVPAIGCTEPVAVAFAVAKAKEILGCLPEKIDVSLSANVLKNAMGVGIPGTGMIGLPIAIALGAITGKSEYGLEVLKDITNNALEQGKKMIEEKKINISLCENAPNQLYIATTVKNGSESVKVVVCEEHTKIVRIEKNGKTIFEEKISPAEENNTEITQTLSMRKVYDFAMETPTDDIKFILEAAKINSAAAEKALNMSYGHSLGRTMTGIYEHQIMGDSMLSKILAYTSSACDARMGGAMIPVMTNSGSGNQGITATLPVAVFAREMKKSEEQLIRALILSSLTVIYIKQSMGRLSALCGCVVASTGSACGITYLMGGGYEQICYAVKNMVANLAGMVCDGAKPSCSLKVSSSAATAVFSAMMAMEGKFVKSVEGIIDNDVDKSIHNLTRIASSGMCETDKMILEIMTGK

📊 Sample Types

Isolate 29.4%
Metagenome 70.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 50.0%
Kalotermitidae 17.1%
Termitidae 13.4%
Unclassified 8.5%
Rhinotermitidae 3.7%
Termopsidae 3.7%
Passalidae 2.4%
Hodotermitidae 1.2%

🌳 Taxonomy

Archaea 0
Bacteria 157
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
2 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
3 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
4 2940400224 Paenibacillus sp. PastM-2 Isolate Blattidae
5 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
6 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
7 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
8 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
9 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
10 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
11 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
12 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
13 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
14 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
15 2940406939 Paenibacillus sp. PastM-3 Isolate Blattidae
16 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
17 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
18 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
19 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
20 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
21 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
22 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
23 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
24 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
25 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
26 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
27 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
28 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
29 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
30 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
31 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
32 2940386776 Paenibacillus sp. PastF-1 Isolate Blattidae
33 3004672520 Bacteroides sp. 51 Isolate Blattidae
34 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
35 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
36 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
37 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
38 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
39 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
40 2820792843 Unclassified Bacteroidetes Cu122P3bin1 Isolate Unclassified
41 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
42 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
43 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
44 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae
45 3004677695 Bacteroides sp. 214 Isolate Blattidae
46 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
47 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
48 2923982719 Parabacteroides sp. 52 Isolate Blattidae
49 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
50 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
51 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
52 2940419646 Paenibacillus sp. PastF-4 Isolate Blattidae
53 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
54 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
55 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
56 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
57 2820795054 Unclassified Bacteroidetes Cu122P1bin21 Isolate Unclassified
58 2922326829 Bacteroides sp. 224 Isolate Blattidae
59 2940221333 Paenibacillus sp. PastF-3 Isolate Blattidae
60 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
61 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
62 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
63 2940425923 Paenibacillus sp. PastH-4 Isolate Blattidae
64 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
65 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
66 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
67 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
68 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
69 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
70 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
71 2940380068 Paenibacillus sp. PastH-2 Isolate Blattidae
72 2940413413 Paenibacillus sp. PastH-3 Isolate Blattidae
73 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
74 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
75 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
76 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
77 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
78 3004667792 Bacteroides sp. 519 Isolate Blattidae
79 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
80 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
81 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
82 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
83 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_124204 3300042612 Bacteria 47476
2 Ga0466705_212723 3300042612 Bacteria 3592
3 Ga0466715_045980 3300042616 Bacteria 33517
4 Ga0466735_217815 3300042624 Bacteria 1768
5 Ga0466724_50759 3300042649 Bacteria 4502
6 Ga0466727_215099 3300042655 Bacteria 1655
7 Ga0160452_100659 3300012834 Bacteria 17948
8 Ga0466696_070746 3300042596 Bacteria 74081
9 Ga0466696_136965 3300042596 Bacteria 5525
10 Ga0466696_251801 3300042596 Bacteria 32029
11 IMNBL1DRAFT_c0000059 3300000062 Bacteria 103534
12 IMNBL1DRAFT_c0013142 3300000062 Bacteria 3736
13 JGI24702J35022_10105898 3300002462 Bacteria 1543
14 Ga0466713_051288 3300042602 Bacteria 230715
15 Ga0466713_143155 3300042602 Bacteria 188721
16 Ga0466714_075303 3300042603 Bacteria 17951
17 Ga0466716_056469 3300042605 Bacteria 5667
18 Ga0466697_176725 3300042611 Bacteria 2995
19 Ga0466733_094314 3300042659 Unclassified 1707
20 Ga0466715_440066 3300042616 Bacteria 13179
21 Ga0466723_064929 3300042618 Bacteria 41064
22 Ga0466728_044515 3300042620 Bacteria 5778
23 Ga0466728_192677 3300042620 Bacteria 2484
24 Ga0466729_038665 3300042621 Bacteria 15259
25 Ga0466703_242939 3300042636 Bacteria 13750
26 Ga0466704_235767 3300042643 Bacteria 4757
27 Ga0466708_027130 3300042652 Bacteria 4645
28 Ga0466708_139052 3300042652 Bacteria 5245
29 Ga0466690_225246 3300042590 Bacteria 6354
30 Ga0466691_163200 3300042593 Bacteria 4992
31 Ga0466696_496124 3300042596 Bacteria 2353
32 Ga0466706_138933 3300042599 Bacteria 6203
33 Ga0466707_044234 3300042601 Bacteria 8494
34 Ga0466713_033702 3300042602 Bacteria 18682
35 Ga0466713_052484 3300042602 Bacteria 51192
36 Ga0466714_159678 3300042603 Bacteria 13291
37 Ga0466716_011142 3300042605 Bacteria 3530
38 Ga0466723_141568 3300042618 Bacteria 16577
39 Ga0466735_078756 3300042624 Bacteria 2833
40 Ga0466735_127512 3300042624 Bacteria 15862
41 Ga0466657_273247 3300042582 Bacteria 4220
42 IMNBL1DRAFT_c0000937 3300000062 Bacteria 22532
43 Ga0466706_171746 3300042599 Bacteria 69301
44 Ga0466707_012189 3300042601 Bacteria 5935
45 Ga0466733_055750 3300042659 Bacteria 12185
46 Ga0466705_494792 3300042612 Bacteria 3038
47 Ga0466711_451493 3300042615 Bacteria 10844
48 Ga0466715_170026 3300042616 Bacteria 29950
49 Ga0466731_088179 3300042622 Bacteria 4690
50 Ga0466735_002261 3300042624 Bacteria 2668
51 Ga0466704_189809 3300042643 Bacteria 10799
52 Ga0466709_081332 3300042648 Unclassified 50852
53 Ga0466709_298775 3300042648 Bacteria 18829
54 Ga0466709_328692 3300042648 Bacteria 228895
55 Ga0466708_225726 3300042652 Bacteria 5929
56 Ga0466706_028005 3300042599 Bacteria 12952
57 Ga0466706_034191 3300042599 Bacteria 44289
58 Ga0466706_163481 3300042599 Bacteria 45216
59 Ga0466707_296253 3300042601 Bacteria 25031
60 Ga0466713_009775 3300042602 Bacteria 66246
61 Ga0466713_020351 3300042602 Bacteria 91390
62 Ga0466733_061316 3300042659 Bacteria 145079
63 Ga0466710_032215 3300042613 Bacteria 1496
64 Ga0466711_114294 3300042615 Bacteria 16823
65 Ga0466711_350231 3300042615 Bacteria 5994
66 Ga0466726_224822 3300042619 Bacteria 3003
67 Ga0466691_023019 3300042593 Bacteria 12671
68 Ga0466691_050053 3300042593 Bacteria 6806
69 Ga0466691_163996 3300042593 Bacteria 6431
70 Ga0466696_049113 3300042596 Bacteria 63300
71 Ga0466696_190653 3300042596 Bacteria 1472
72 Ga0466714_099856 3300042603 Bacteria 26552
73 Ga0466719_124633 3300042606 Bacteria 9034
74 Ga0466711_092017 3300042615 Bacteria 9384
75 Ga0466711_494046 3300042615 Bacteria 3696
76 Ga0466715_066044 3300042616 Bacteria 3702
77 Ga0466723_023030 3300042618 Bacteria 16011
78 Ga0466703_225503 3300042636 Bacteria 9103
79 Ga0466704_216571 3300042643 Bacteria 9337
80 Ga0466704_446923 3300042643 Bacteria 3231
81 Ga0466704_502176 3300042643 Bacteria 1835
82 Ga0466690_180282 3300042590 Bacteria 25954
83 Ga0466694_321800 3300042594 Bacteria 29415
84 Ga0466695_212656 3300042595 Bacteria 4744
85 Ga0068305_10172136 3300005083 Unclassified 4668
86 Ga0466706_037437 3300042599 Bacteria 17939
87 Ga0466706_121012 3300042599 Bacteria 39559
88 Ga0466705_185873 3300042612 Bacteria 9001
89 Ga0466733_141558 3300042659 Bacteria 10167
90 Ga0466703_367008 3300042636 Bacteria 30950
91 Ga0466691_095246 3300042593 Bacteria 18091
92 Ga0466691_099055 3300042593 Bacteria 3675
93 IMNBL1DRAFT_c0001443 3300000062 Bacteria 17766
94 Ga0466706_134925 3300042599 Bacteria 10927
95 Ga0466707_213366 3300042601 Bacteria 3914
96 Ga0466713_041499 3300042602 Bacteria 101217
97 Ga0466714_008609 3300042603 Bacteria 4341
98 Ga0466717_083168 3300042604 Bacteria 1553
99 Ga0466710_107103 3300042613 Bacteria 16718
100 Ga0466711_023837 3300042615 Bacteria 62988
101 Ga0466715_111811 3300042616 Bacteria 33974
102 Ga0466715_165372 3300042616 Bacteria 16231
103 Ga0466729_264172 3300042621 Bacteria 5257
104 Ga0466735_222090 3300042624 Bacteria 5320
105 Ga0466709_017802 3300042648 Bacteria 72752
106 Ga0466690_354941 3300042590 Bacteria 44034
107 Ga0466696_113588 3300042596 Bacteria 6004
108 2227155811 2225789004 Bacteria 8444
109 IMNBL1DRAFT_c0005049 3300000062 Bacteria 7687
110 Ga0466706_027208 3300042599 Bacteria 10452
111 Ga0466707_112391 3300042601 Bacteria 11861
112 Ga0466713_093396 3300042602 Bacteria 9732
113 Ga0466713_093846 3300042602 Bacteria 70842

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00581 Rhodanese Rhodanese-like domain 7 77 0.91
PF03313 SDH_alpha Serine dehydratase alpha chain 168 504 0.88

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.