Protein Family IF08256
Metagenome
Isolate
148
Members
46
Samples
142
Scaffolds
89.64
Avg Length
Representative Sequence
- ID
- 3300042619|Ga0466726_192721|Ga0466726_192721_690_1022
- Length
- 110 aa
- Sequence
- MEAFNMNVKMSNFGDILLSRPAGREAFLMARAYVFKGIQPVEDIILDFSDIKVLAPSWIDEFITGIKSGYSNKLACLNTENPSVAASLKTVLAPRPQVLTSFKVIISSSL
Sample Types
Isolate
4.0%
Metagenome
96.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
48.9%
Kalotermitidae
22.2%
Unclassified
15.6%
Termopsidae
8.9%
Rhinotermitidae
4.4%
Taxonomy
Archaea
0
Bacteria
140
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 3 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 4 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 5 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 6 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 7 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 8 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 9 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 10 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 11 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 12 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 13 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 14 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 15 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 16 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 17 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 18 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 19 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 20 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 21 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 22 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 23 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 24 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 25 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 26 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 27 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 28 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 29 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 30 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 31 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 32 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 33 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 34 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 35 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 36 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 37 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 38 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 39 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 40 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 41 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 42 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 43 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 44 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 45 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 46 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_023989 | 3300042659 | Bacteria | 3809 |
| 2 | Ga0466707_062045 | 3300042601 | Bacteria | 1069 |
| 3 | Ga0466716_053459 | 3300042605 | Bacteria | 5839 |
| 4 | Ga0466719_132955 | 3300042606 | Bacteria | 1860 |
| 5 | Ga0123356_12649747 | 3300010049 | Bacteria | 628 |
| 6 | Ga0123353_10919233 | 3300010167 | Bacteria | 1188 |
| 7 | JGI24695J34938_10159251 | 3300002450 | Bacteria | 927 |
| 8 | Ga0068302_10187940 | 3300005071 | Bacteria | 990 |
| 9 | Ga0466727_213875 | 3300042655 | Bacteria | 1248 |
| 10 | Ga0466727_337899 | 3300042655 | Bacteria | 1254 |
| 11 | Ga0466712_272877 | 3300042614 | Bacteria | 4143 |
| 12 | Ga0466729_179836 | 3300042621 | Bacteria | 1054 |
| 13 | Ga0466705_215394 | 3300042612 | Bacteria | 1243 |
| 14 | Ga0466691_005178 | 3300042593 | Bacteria | 2216 |
| 15 | Ga0466694_012452 | 3300042594 | Bacteria | 3719 |
| 16 | Ga0466694_030381 | 3300042594 | Bacteria | 1315 |
| 17 | Ga0466694_254620 | 3300042594 | Bacteria | 1459 |
| 18 | Ga0466699_066378 | 3300042597 | Bacteria | 1111 |
| 19 | Ga0466717_292783 | 3300042604 | Bacteria | 1097 |
| 20 | Ga0123356_10045262 | 3300010049 | Bacteria | 4095 |
| 21 | Ga0123356_12346966 | 3300010049 | Bacteria | 667 |
| 22 | Ga0123353_12527573 | 3300010167 | Bacteria | 610 |
| 23 | Ga0072941_1036658 | 3300005201 | Bacteria | 2451 |
| 24 | Ga0466735_199674 | 3300042624 | Bacteria | 1543 |
| 25 | Ga0466702_204915 | 3300042635 | Bacteria | 1096 |
| 26 | Ga0466703_210110 | 3300042636 | Bacteria | 87073 |
| 27 | Ga0466704_124285 | 3300042643 | Bacteria | 2414 |
| 28 | Ga0466727_142246 | 3300042655 | Bacteria | 4021 |
| 29 | Ga0466712_031052 | 3300042614 | Bacteria | 1390 |
| 30 | Ga0466726_279178 | 3300042619 | Bacteria | 1376 |
| 31 | Ga0466726_312563 | 3300042619 | Bacteria | 1848 |
| 32 | Ga0466690_148995 | 3300042590 | Bacteria | 1809 |
| 33 | Ga0466695_141338 | 3300042595 | Bacteria | 4553 |
| 34 | Ga0466699_354451 | 3300042597 | Bacteria | 3332 |
| 35 | Ga0466700_299022 | 3300042600 | Bacteria | 1098 |
| 36 | Ga0466720_030037 | 3300042607 | Bacteria | 1468 |
| 37 | AustNasuHG_c1004172 | 3300000089 | Bacteria | 5193 |
| 38 | AustNasuHG_c1030357 | 3300000089 | Bacteria | 1557 |
| 39 | AustNasuHG_c1030611 | 3300000089 | Bacteria | 1545 |
| 40 | JGI24702J35022_10002358 | 3300002462 | Bacteria | 11552 |
| 41 | JGI24702J35022_10066666 | 3300002462 | Bacteria | 1932 |
| 42 | Ga0072941_1046244 | 3300005201 | Bacteria | 4886 |
| 43 | Ga0072941_1087614 | 3300005201 | Unclassified | 1263 |
| 44 | Ga0466734_148147 | 3300042623 | Bacteria | 1363 |
| 45 | Ga0466703_209752 | 3300042636 | Bacteria | 1236 |
| 46 | Ga0466704_579289 | 3300042643 | Bacteria | 2568 |
| 47 | Ga0466727_255569 | 3300042655 | Bacteria | 8054 |
| 48 | Ga0466726_447647 | 3300042619 | Bacteria | 1094 |
| 49 | Ga0466694_385670 | 3300042594 | Bacteria | 1275 |
| 50 | Ga0466699_050864 | 3300042597 | Bacteria | 1076 |
| 51 | Ga0466699_182313 | 3300042597 | Bacteria | 3086 |
| 52 | Ga0466699_431885 | 3300042597 | Bacteria | 1169 |
| 53 | Ga0466707_354808 | 3300042601 | Bacteria | 1072 |
| 54 | Ga0123353_11365269 | 3300010167 | Bacteria | 914 |
| 55 | Ga0123353_11659394 | 3300010167 | Bacteria | 803 |
| 56 | Ga0123353_11772910 | 3300010167 | Bacteria | 769 |
| 57 | Ga0068305_10530025 | 3300005083 | Bacteria | 9937 |
| 58 | Ga0072941_1001794 | 3300005201 | Bacteria | 25495 |
| 59 | Ga0466702_330158 | 3300042635 | Bacteria | 13833 |
| 60 | Ga0466704_284210 | 3300042643 | Bacteria | 2245 |
| 61 | Ga0466728_163582 | 3300042620 | Bacteria | 2628 |
| 62 | Ga0466656_252015 | 3300042550 | Bacteria | 1407 |
| 63 | Ga0466699_061551 | 3300042597 | Bacteria | 3991 |
| 64 | Ga0466699_068722 | 3300042597 | Bacteria | 2026 |
| 65 | Ga0466699_097544 | 3300042597 | Bacteria | 2833 |
| 66 | Ga0466699_374590 | 3300042597 | Unclassified | 2164 |
| 67 | Ga0466707_121368 | 3300042601 | Bacteria | 1431 |
| 68 | Ga0466719_532831 | 3300042606 | Unclassified | 1060 |
| 69 | Ga0123356_11394147 | 3300010049 | Bacteria | 861 |
| 70 | Ga0123353_11428572 | 3300010167 | Bacteria | 887 |
| 71 | JGI24695J34938_10037549 | 3300002450 | Bacteria | 2200 |
| 72 | Ga0072941_1006873 | 3300005201 | Bacteria | 20704 |
| 73 | Ga0466702_400920 | 3300042635 | Bacteria | 1470 |
| 74 | Ga0466727_138728 | 3300042655 | Bacteria | 1049 |
| 75 | Ga0466727_296807 | 3300042655 | Bacteria | 1370 |
| 76 | Ga0466723_052655 | 3300042618 | Bacteria | 4529 |
| 77 | Ga0466694_237948 | 3300042594 | Bacteria | 1356 |
| 78 | Ga0466699_207627 | 3300042597 | Unclassified | 1154 |
| 79 | Ga0466707_138136 | 3300042601 | Bacteria | 1831 |
| 80 | Ga0466722_077641 | 3300042609 | Bacteria | 1898 |
| 81 | Ga0466698_409754 | 3300042610 | Bacteria | 1292 |
| 82 | Ga0123357_10390634 | 3300009784 | Bacteria | 1279 |
| 83 | Ga0123356_11144240 | 3300010049 | Unclassified | 946 |
| 84 | Ga0123356_12257202 | 3300010049 | Bacteria | 680 |
| 85 | Ga0123353_11076285 | 3300010167 | Bacteria | 1071 |
| 86 | Ga0123353_11388488 | 3300010167 | Bacteria | 904 |
| 87 | JGI24702J35022_10077214 | 3300002462 | Bacteria | 1801 |
| 88 | Ga0072941_1067376 | 3300005201 | Bacteria | 2100 |
| 89 | Ga0072941_1286190 | 3300005201 | Bacteria | 576 |
| 90 | Ga0072941_1331838 | 3300005201 | Bacteria | 763 |
| 91 | Ga0466703_017118 | 3300042636 | Bacteria | 15056 |
| 92 | Ga0466727_306007 | 3300042655 | Bacteria | 1342 |
| 93 | Ga0466718_127755 | 3300042617 | Bacteria | 5201 |
| 94 | Ga0466726_213552 | 3300042619 | Bacteria | 19773 |
| 95 | Ga0466726_310026 | 3300042619 | Bacteria | 1106 |
| 96 | Ga0466726_371740 | 3300042619 | Bacteria | 1476 |
| 97 | Ga0466705_062791 | 3300042612 | Bacteria | 1352 |
| 98 | Ga0466699_064563 | 3300042597 | Bacteria | 1095 |
| 99 | Ga0466699_071522 | 3300042597 | Bacteria | 1440 |
| 100 | Ga0466699_129225 | 3300042597 | Unclassified | 1017 |
| 101 | Ga0466699_241240 | 3300042597 | Bacteria | 1228 |
| 102 | Ga0466699_338698 | 3300042597 | Bacteria | 62334 |
| 103 | Ga0466707_026713 | 3300042601 | Bacteria | 2520 |
| 104 | Ga0466707_235155 | 3300042601 | Bacteria | 1455 |
| 105 | Ga0466707_313296 | 3300042601 | Bacteria | 1590 |
| 106 | Ga0466720_113496 | 3300042607 | Bacteria | 1362 |
| 107 | Ga0466698_385597 | 3300042610 | Bacteria | 1228 |
| 108 | Ga0123356_10002253 | 3300010049 | Bacteria | 20803 |
| 109 | Ga0123356_10381055 | 3300010049 | Bacteria | 1543 |
| 110 | AustNasuHG_c1004826 | 3300000089 | Bacteria | 4828 |
| 111 | AustNasuHG_c1009489 | 3300000089 | Bacteria | 3415 |
| 112 | JGI24698J34947_10026507 | 3300002449 | Bacteria | 3079 |
| 113 | JGI24695J34938_10084036 | 3300002450 | Bacteria | 1312 |
| 114 | JGI24702J35022_10078071 | 3300002462 | Bacteria | 1791 |
| 115 | JGI24705J35276_12177303 | 3300002504 | Bacteria | 1338 |
| 116 | Ga0074263_135800 | 3300005485 | Bacteria | 867 |
| 117 | Ga0466735_100405 | 3300042624 | Bacteria | 2600 |
| 118 | Ga0466703_225557 | 3300042636 | Unclassified | 1066 |
| 119 | Ga0466718_078627 | 3300042617 | Bacteria | 5896 |
| 120 | Ga0466718_135735 | 3300042617 | Bacteria | 1690 |
| 121 | Ga0466718_142539 | 3300042617 | Bacteria | 1191 |
| 122 | Ga0466726_192721 | 3300042619 | Bacteria | 1211 |
| 123 | Ga0466726_407983 | 3300042619 | Bacteria | 1649 |
| 124 | Ga0466726_455637 | 3300042619 | Bacteria | 2329 |
| 125 | Ga0466690_296428 | 3300042590 | Bacteria | 2577 |
| 126 | Ga0466694_070366 | 3300042594 | Bacteria | 1483 |
| 127 | Ga0466695_391011 | 3300042595 | Bacteria | 1270 |
| 128 | Ga0466699_045947 | 3300042597 | Bacteria | 18961 |
| 129 | Ga0466699_159650 | 3300042597 | Bacteria | 5388 |
| 130 | Ga0466699_290165 | 3300042597 | Bacteria | 2761 |
| 131 | Ga0466707_043607 | 3300042601 | Bacteria | 1212 |
| 132 | Ga0466707_177860 | 3300042601 | Bacteria | 1297 |
| 133 | Ga0466698_226069 | 3300042610 | Bacteria | 2346 |
| 134 | Ga0123356_11022242 | 3300010049 | Bacteria | 996 |
| 135 | JGI24695J34938_10006696 | 3300002450 | Bacteria | 6864 |
| 136 | JGI24695J34938_10164766 | 3300002450 | Bacteria | 912 |
| 137 | JGI24695J34938_10464488 | 3300002450 | Bacteria | 574 |
| 138 | Ga0072941_1002036 | 3300005201 | Bacteria | 1374 |
| 139 | Ga0466729_205642 | 3300042621 | Unclassified | 1488 |
| 140 | Ga0466735_091383 | 3300042624 | Bacteria | 1185 |
| 141 | Ga0466711_374414 | 3300042615 | Bacteria | 4543 |
| 142 | Ga0466726_063337 | 3300042619 | Bacteria | 8853 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF14213 | DUF4325 | STAS-like domain of unknown function (DUF4325) | 33 | 78 | 0.82 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.