Protein Family IF08239
Metagenome
Isolate
166
Members
37
Samples
163
Scaffolds
286.38
Avg Length
Representative Sequence
- ID
- 3300042619|Ga0466726_139609|Ga0466726_139609_19104_20054
- Length
- 316 aa
- Sequence
- VERFKPLYNVDTVFNSFGGMPMQGLDDRTRDLIQRRVLKRVKDIPSLPQFVVETLNKLDDPKSSASDVGMKLAKDEGLVLRVLRLANSAYYGLSRRITGVSEAISFLGFKTVKSIVLAASVYKFMDGAFTGYSLDRGELWRHSQGVAATSRYLSEKLKVGDAEEAYIGGLMHDIGKIVLNDYVRFGYSIILRLVEEDGVPFSEAERQVLGFDHAQVGGLVMEQWNLPDAYSYITTYHHSPWNLPPDMTEHQKTLDIVHVSNVMCLMLGLGMGADGMQYNISEDSLERLGIADQTEHIMAEFVDIISAMEDDFKTTN
Sample Types
Isolate
1.8%
Metagenome
98.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
37.8%
Termitidae
29.7%
Unclassified
13.5%
Termopsidae
10.8%
Rhinotermitidae
5.4%
Hodotermitidae
2.7%
Taxonomy
Archaea
0
Bacteria
135
Eukaryota
0
Viruses
0
Unclassified
31
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820007728 | Unclassified Synergistetes Lab288P3bin114 | Isolate | Unclassified |
| 2 | 2758568796 | Unclassified Deltaproteobacteria Th196P3_bin21 | Isolate | Unclassified |
| 3 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 4 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 5 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 6 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 7 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 8 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 9 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 10 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 11 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 2820001644 | Unclassified Synergistetes Th196P3bin106 | Isolate | Unclassified |
| 14 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 15 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 16 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 17 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 18 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 19 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 20 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 21 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 22 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 23 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 24 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 25 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 26 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 27 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 28 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 29 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 30 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 31 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 32 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 33 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 34 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 35 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 36 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 37 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_023144 | 3300042659 | Bacteria | 13353 |
| 2 | Ga0466705_465944 | 3300042612 | Bacteria | 15809 |
| 3 | Ga0466705_512301 | 3300042612 | Bacteria | 2033 |
| 4 | Ga0466712_043200 | 3300042614 | Unclassified | 4700 |
| 5 | Ga0466711_226860 | 3300042615 | Bacteria | 3145 |
| 6 | Ga0466715_019851 | 3300042616 | Bacteria | 10536 |
| 7 | Ga0466715_603854 | 3300042616 | Bacteria | 13515 |
| 8 | Ga0466723_098522 | 3300042618 | Bacteria | 1563 |
| 9 | Ga0466723_178323 | 3300042618 | Bacteria | 48138 |
| 10 | Ga0466728_168713 | 3300042620 | Bacteria | 15463 |
| 11 | Ga0466728_252860 | 3300042620 | Bacteria | 3642 |
| 12 | Ga0466691_008229 | 3300042593 | Unclassified | 24841 |
| 13 | Ga0466691_200700 | 3300042593 | Unclassified | 5756 |
| 14 | Ga0466713_062152 | 3300042602 | Bacteria | 29476 |
| 15 | Ga0466716_124636 | 3300042605 | Bacteria | 2495 |
| 16 | Ga0466716_136744 | 3300042605 | Bacteria | 1578 |
| 17 | Ga0123353_10266704 | 3300010167 | Bacteria | 2641 |
| 18 | Ga0466704_373063 | 3300042643 | Bacteria | 5772 |
| 19 | Ga0466704_597500 | 3300042643 | Unclassified | 5527 |
| 20 | Ga0466725_067088 | 3300042654 | Bacteria | 5508 |
| 21 | Ga0466705_226134 | 3300042612 | Unclassified | 29172 |
| 22 | Ga0466705_296714 | 3300042612 | Unclassified | 16249 |
| 23 | Ga0466705_481612 | 3300042612 | Bacteria | 10787 |
| 24 | Ga0466711_176332 | 3300042615 | Bacteria | 26503 |
| 25 | Ga0466711_232832 | 3300042615 | Bacteria | 7530 |
| 26 | Ga0466711_342540 | 3300042615 | Bacteria | 10296 |
| 27 | Ga0466715_221916 | 3300042616 | Bacteria | 38750 |
| 28 | Ga0466723_009986 | 3300042618 | Bacteria | 61591 |
| 29 | Ga0466723_357626 | 3300042618 | Bacteria | 26636 |
| 30 | Ga0466728_172328 | 3300042620 | Bacteria | 16627 |
| 31 | Ga0466729_037018 | 3300042621 | Bacteria | 2277 |
| 32 | Ga0466696_297452 | 3300042596 | Unclassified | 1514 |
| 33 | Ga0466716_419574 | 3300042605 | Bacteria | 4088 |
| 34 | Ga0466716_454204 | 3300042605 | Bacteria | 2322 |
| 35 | Ga0466722_152609 | 3300042609 | Bacteria | 2147 |
| 36 | Ga0123353_10189998 | 3300010167 | Bacteria | 3243 |
| 37 | Ga0466704_133731 | 3300042643 | Bacteria | 2220 |
| 38 | Ga0466708_458659 | 3300042652 | Bacteria | 35114 |
| 39 | Ga0466727_019536 | 3300042655 | Unclassified | 16146 |
| 40 | Ga0466727_134526 | 3300042655 | Bacteria | 1283 |
| 41 | Ga0466727_238753 | 3300042655 | Bacteria | 3616 |
| 42 | Ga0466705_325821 | 3300042612 | Bacteria | 52454 |
| 43 | Ga0466723_029068 | 3300042618 | Bacteria | 62461 |
| 44 | Ga0466723_051098 | 3300042618 | Unclassified | 3786 |
| 45 | Ga0466723_242215 | 3300042618 | Unclassified | 2275 |
| 46 | Ga0466726_139609 | 3300042619 | Bacteria | 27683 |
| 47 | Ga0466690_300105 | 3300042590 | Bacteria | 2112 |
| 48 | Ga0466707_160056 | 3300042601 | Bacteria | 38958 |
| 49 | Ga0466717_036581 | 3300042604 | Bacteria | 14410 |
| 50 | Ga0123353_10115042 | 3300010167 | Bacteria | 4330 |
| 51 | Ga0123353_10174037 | 3300010167 | Bacteria | 3414 |
| 52 | Ga0072940_1054932 | 3300005200 | Bacteria | 1469 |
| 53 | Ga0466703_273974 | 3300042636 | Bacteria | 93063 |
| 54 | Ga0466704_496825 | 3300042643 | Bacteria | 14573 |
| 55 | Ga0466709_260840 | 3300042648 | Bacteria | 3657 |
| 56 | Ga0466708_449502 | 3300042652 | Bacteria | 4804 |
| 57 | Ga0466705_177521 | 3300042612 | Unclassified | 8502 |
| 58 | Ga0466711_093648 | 3300042615 | Bacteria | 15442 |
| 59 | Ga0466711_121226 | 3300042615 | Bacteria | 40224 |
| 60 | Ga0466711_343566 | 3300042615 | Unclassified | 2741 |
| 61 | Ga0466715_072773 | 3300042616 | Bacteria | 2341 |
| 62 | Ga0466715_303967 | 3300042616 | Bacteria | 16996 |
| 63 | Ga0466723_019226 | 3300042618 | Bacteria | 5432 |
| 64 | Ga0466723_365502 | 3300042618 | Unclassified | 4652 |
| 65 | Ga0466728_071444 | 3300042620 | Bacteria | 40071 |
| 66 | Ga0466696_047433 | 3300042596 | Bacteria | 2566 |
| 67 | Ga0466696_329853 | 3300042596 | Bacteria | 12347 |
| 68 | Ga0466700_380879 | 3300042600 | Bacteria | 4299 |
| 69 | Ga0466716_399452 | 3300042605 | Bacteria | 3923 |
| 70 | Ga0466722_055873 | 3300042609 | Unclassified | 4261 |
| 71 | Ga0466704_112651 | 3300042643 | Bacteria | 58636 |
| 72 | Ga0466704_124222 | 3300042643 | Bacteria | 2229 |
| 73 | Ga0466708_261684 | 3300042652 | Bacteria | 11066 |
| 74 | Ga0466708_312303 | 3300042652 | Bacteria | 76951 |
| 75 | Ga0466725_195460 | 3300042654 | Bacteria | 1173 |
| 76 | Ga0466705_097770 | 3300042612 | Bacteria | 2024 |
| 77 | Ga0466705_371220 | 3300042612 | Bacteria | 11016 |
| 78 | Ga0466711_357067 | 3300042615 | Bacteria | 7438 |
| 79 | Ga0466711_368343 | 3300042615 | Bacteria | 2891 |
| 80 | Ga0466715_181897 | 3300042616 | Bacteria | 30380 |
| 81 | Ga0466715_389700 | 3300042616 | Bacteria | 11834 |
| 82 | Ga0466715_426024 | 3300042616 | Bacteria | 38157 |
| 83 | Ga0466723_033357 | 3300042618 | Bacteria | 10584 |
| 84 | Ga0466723_154777 | 3300042618 | Bacteria | 13657 |
| 85 | Ga0466723_187841 | 3300042618 | Unclassified | 7945 |
| 86 | Ga0466723_250105 | 3300042618 | Bacteria | 2908 |
| 87 | Ga0466723_251334 | 3300042618 | Unclassified | 1806 |
| 88 | Ga0466726_215358 | 3300042619 | Bacteria | 101694 |
| 89 | Ga0466691_151215 | 3300042593 | Bacteria | 3729 |
| 90 | Ga0466696_195624 | 3300042596 | Bacteria | 5247 |
| 91 | Ga0466722_113343 | 3300042609 | Bacteria | 2229 |
| 92 | Ga0123353_10270258 | 3300010167 | Bacteria | 2620 |
| 93 | Ga0466735_152420 | 3300042624 | Bacteria | 1267 |
| 94 | Ga0466709_088652 | 3300042648 | Bacteria | 5858 |
| 95 | Ga0466708_069298 | 3300042652 | Bacteria | 43214 |
| 96 | Ga0466708_162770 | 3300042652 | Bacteria | 9603 |
| 97 | Ga0466705_133293 | 3300042612 | Bacteria | 7371 |
| 98 | Ga0466705_398551 | 3300042612 | Bacteria | 34299 |
| 99 | Ga0466711_172632 | 3300042615 | Bacteria | 4914 |
| 100 | Ga0466711_269797 | 3300042615 | Bacteria | 3729 |
| 101 | Ga0466711_470931 | 3300042615 | Bacteria | 63351 |
| 102 | Ga0466715_375677 | 3300042616 | Bacteria | 8748 |
| 103 | Ga0466715_410481 | 3300042616 | Bacteria | 2836 |
| 104 | Ga0466715_571783 | 3300042616 | Bacteria | 3601 |
| 105 | Ga0466715_619233 | 3300042616 | Bacteria | 8038 |
| 106 | Ga0466723_174501 | 3300042618 | Unclassified | 6008 |
| 107 | Ga0466723_288853 | 3300042618 | Bacteria | 6381 |
| 108 | Ga0466728_402883 | 3300042620 | Bacteria | 2105 |
| 109 | Ga0466690_038148 | 3300042590 | Bacteria | 1706 |
| 110 | Ga0466691_211422 | 3300042593 | Unclassified | 32679 |
| 111 | Ga0466695_297851 | 3300042595 | Bacteria | 1796 |
| 112 | Ga0466716_115178 | 3300042605 | Bacteria | 10728 |
| 113 | Ga0466719_267874 | 3300042606 | Unclassified | 2742 |
| 114 | Ga0123355_10078972 | 3300009826 | Bacteria | 5256 |
| 115 | JGI24698J34947_10003049 | 3300002449 | Bacteria | 9082 |
| 116 | Ga0068302_10002159 | 3300005071 | Bacteria | 3245 |
| 117 | Ga0466729_311466 | 3300042621 | Bacteria | 6776 |
| 118 | Ga0466708_117532 | 3300042652 | Bacteria | 19745 |
| 119 | Ga0466705_507723 | 3300042612 | Unclassified | 18376 |
| 120 | Ga0466715_083770 | 3300042616 | Bacteria | 7756 |
| 121 | Ga0466723_048054 | 3300042618 | Bacteria | 1397 |
| 122 | Ga0466723_244087 | 3300042618 | Unclassified | 57495 |
| 123 | Ga0466723_254450 | 3300042618 | Bacteria | 6589 |
| 124 | Ga0466723_364635 | 3300042618 | Bacteria | 2947 |
| 125 | Ga0466691_119832 | 3300042593 | Unclassified | 8505 |
| 126 | Ga0466696_332960 | 3300042596 | Bacteria | 10589 |
| 127 | Ga0466706_048192 | 3300042599 | Unclassified | 2503 |
| 128 | Ga0466713_066384 | 3300042602 | Bacteria | 19787 |
| 129 | Ga0466719_193433 | 3300042606 | Unclassified | 1184 |
| 130 | Ga0466703_082771 | 3300042636 | Unclassified | 1699 |
| 131 | Ga0466709_287789 | 3300042648 | Unclassified | 11704 |
| 132 | Ga0466709_318025 | 3300042648 | Bacteria | 1061 |
| 133 | Ga0466705_016701 | 3300042612 | Bacteria | 43849 |
| 134 | Ga0466705_263133 | 3300042612 | Unclassified | 21147 |
| 135 | Ga0466705_301038 | 3300042612 | Bacteria | 7869 |
| 136 | Ga0466705_406884 | 3300042612 | Unclassified | 1260 |
| 137 | Ga0466705_429985 | 3300042612 | Bacteria | 40112 |
| 138 | Ga0466711_287846 | 3300042615 | Unclassified | 16975 |
| 139 | Ga0466715_237301 | 3300042616 | Bacteria | 10813 |
| 140 | Ga0466715_254920 | 3300042616 | Bacteria | 13360 |
| 141 | Ga0466723_202264 | 3300042618 | Bacteria | 6472 |
| 142 | Ga0466726_003662 | 3300042619 | Bacteria | 16690 |
| 143 | Ga0466728_212501 | 3300042620 | Unclassified | 5100 |
| 144 | Ga0466691_060345 | 3300042593 | Bacteria | 18106 |
| 145 | Ga0466696_002059 | 3300042596 | Bacteria | 18629 |
| 146 | Ga0466707_246086 | 3300042601 | Bacteria | 8742 |
| 147 | Ga0466719_029960 | 3300042606 | Bacteria | 5538 |
| 148 | Ga0466722_127228 | 3300042609 | Bacteria | 13524 |
| 149 | Ga0466722_147611 | 3300042609 | Bacteria | 17601 |
| 150 | Ga0123355_10281869 | 3300009826 | Bacteria | 2293 |
| 151 | Ga0123353_10057937 | 3300010167 | Bacteria | 6206 |
| 152 | JGI24698J34947_10021477 | 3300002449 | Bacteria | 3472 |
| 153 | Ga0466735_067977 | 3300042624 | Bacteria | 3027 |
| 154 | Ga0466702_307661 | 3300042635 | Bacteria | 1639 |
| 155 | Ga0466703_198357 | 3300042636 | Bacteria | 2547 |
| 156 | Ga0466703_224401 | 3300042636 | Bacteria | 4617 |
| 157 | Ga0466703_263494 | 3300042636 | Unclassified | 2361 |
| 158 | Ga0466703_293020 | 3300042636 | Bacteria | 17209 |
| 159 | Ga0466709_108089 | 3300042648 | Bacteria | 2909 |
| 160 | Ga0466708_031019 | 3300042652 | Bacteria | 24657 |
| 161 | Ga0466708_186399 | 3300042652 | Bacteria | 63543 |
| 162 | Ga0466708_368921 | 3300042652 | Bacteria | 11974 |
| 163 | Ga0466708_428999 | 3300042652 | Bacteria | 29823 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.