Protein Family IF08221
Metagenome
Isolate
304
Members
90
Samples
262
Scaffolds
282.41
Avg Length
Representative Sequence
- ID
- 3300042619|Ga0466726_098670|Ga0466726_098670_92_1009
- Length
- 305 aa
- Sequence
- VSQTITAFFSELQSRPSRSAFFIVNHNQTMKKQVAVQGIIGSYHEIAARNFFKDEDINIIGCDTFQDVISTVKRRSDILGAMAIENTIAGSLLQNHELIRKSGLTVIGEHKLRISHCLAALPGTAVSNLQSIGSHPMALMQCEQFLNTFHSVQIIEKEDTATSARQIAENRLENHAAICSKEAARIYGLEILAEAVETNKHNFTRFLILAEPNTVKETDRIKNKASLVFALPHTVGSLSQVLAVLSFYTMNLSKIQSFPMIGAAWEYLFYADLTFSDYSRYKQSLDAILPLTKDLKILGEYAESD
Sample Types
Isolate
13.8%
Metagenome
86.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
33.3%
Termitidae
21.1%
Kalotermitidae
15.6%
Unclassified
12.2%
Rhinotermitidae
6.7%
Termopsidae
4.4%
Passalidae
3.3%
Hydrophilidae
2.2%
Tenebrionidae
1.1%
Taxonomy
Archaea
0
Bacteria
294
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 2 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 3 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 4 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 5 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 6 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 7 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 8 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 9 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 10 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 11 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 12 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 13 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 14 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 15 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 16 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 17 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 18 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 19 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 20 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 21 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 22 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 23 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 24 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 25 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 26 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 27 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 28 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 29 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 30 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 31 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 32 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 33 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 34 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 35 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 36 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 37 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 38 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 39 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 40 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 41 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 42 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 43 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 44 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 45 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 46 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 47 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 48 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 49 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 50 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 51 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 52 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 53 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 54 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 55 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 56 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 57 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 58 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 59 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 60 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 61 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 62 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 63 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 64 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 65 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 66 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 67 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 68 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 69 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 70 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 71 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 72 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 73 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 74 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 75 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 76 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 77 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 78 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 79 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 80 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 81 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 82 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 83 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 84 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 85 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 86 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 87 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 88 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 89 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 90 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 2 | Ga0123354_10003291 | 3300010882 | Bacteria | 22202 |
| 3 | Ga0123354_10014675 | 3300010882 | Bacteria | 12208 |
| 4 | Ga0123354_10270818 | 3300010882 | Bacteria | 1672 |
| 5 | Ga0466707_111106 | 3300042601 | Bacteria | 10236 |
| 6 | Ga0466707_183678 | 3300042601 | Bacteria | 8035 |
| 7 | Ga0466714_027882 | 3300042603 | Bacteria | 10660 |
| 8 | Ga0466714_037253 | 3300042603 | Bacteria | 40676 |
| 9 | Ga0466719_221716 | 3300042606 | Bacteria | 1016 |
| 10 | Ga0466719_355624 | 3300042606 | Bacteria | 2113 |
| 11 | Ga0466690_266611 | 3300042590 | Bacteria | 2574 |
| 12 | 2227470190 | 2225789004 | Bacteria | 4933 |
| 13 | IMNBL1DRAFT_c0003956 | 3300000062 | Bacteria | 9160 |
| 14 | IMNBL1DRAFT_c0006539 | 3300000062 | Unclassified | 6346 |
| 15 | JGI24702J35022_10201343 | 3300002462 | Bacteria | 1140 |
| 16 | Ga0466711_171347 | 3300042615 | Bacteria | 2574 |
| 17 | Ga0466715_225738 | 3300042616 | Bacteria | 51802 |
| 18 | Ga0466723_220522 | 3300042618 | Bacteria | 6169 |
| 19 | Ga0466726_060600 | 3300042619 | Bacteria | 8532 |
| 20 | Ga0466731_127873 | 3300042622 | Bacteria | 1284 |
| 21 | Ga0466735_024126 | 3300042624 | Bacteria | 1083 |
| 22 | Ga0466735_077212 | 3300042624 | Bacteria | 1598 |
| 23 | Ga0466703_096351 | 3300042636 | Bacteria | 3319 |
| 24 | Ga0466703_248121 | 3300042636 | Bacteria | 12446 |
| 25 | Ga0466703_354739 | 3300042636 | Bacteria | 14499 |
| 26 | Ga0466708_179764 | 3300042652 | Unclassified | 5549 |
| 27 | Ga0466708_312676 | 3300042652 | Bacteria | 4169 |
| 28 | Ga0466708_373102 | 3300042652 | Bacteria | 35091 |
| 29 | Ga0466727_119534 | 3300042655 | Bacteria | 1446 |
| 30 | Ga0466733_061316 | 3300042659 | Bacteria | 145079 |
| 31 | Ga0123357_10020591 | 3300009784 | Bacteria | 8821 |
| 32 | Ga0123357_10053155 | 3300009784 | Bacteria | 5467 |
| 33 | Ga0123357_10218381 | 3300009784 | Bacteria | 2122 |
| 34 | Ga0123353_10000206 | 3300010167 | Bacteria | 74863 |
| 35 | Ga0466700_260113 | 3300042600 | Bacteria | 2975 |
| 36 | Ga0466700_441738 | 3300042600 | Bacteria | 12466 |
| 37 | Ga0466713_144585 | 3300042602 | Bacteria | 11590 |
| 38 | Ga0466716_475313 | 3300042605 | Bacteria | 12267 |
| 39 | Ga0466722_199756 | 3300042609 | Bacteria | 5076 |
| 40 | Ga0466722_236552 | 3300042609 | Bacteria | 22260 |
| 41 | Ga0456237_0010191 | 3300041968 | Bacteria | 1391 |
| 42 | Ga0466694_115206 | 3300042594 | Bacteria | 1278 |
| 43 | 2227397471 | 2225789004 | Bacteria | 5810 |
| 44 | IMNBL1DRAFT_c0001510 | 3300000062 | Bacteria | 17342 |
| 45 | JGI24702J35022_10016758 | 3300002462 | Bacteria | 4013 |
| 46 | Ga0068305_10049092 | 3300005083 | Bacteria | 12491 |
| 47 | Ga0466711_024998 | 3300042615 | Bacteria | 17622 |
| 48 | Ga0466711_054882 | 3300042615 | Bacteria | 7568 |
| 49 | Ga0466715_037900 | 3300042616 | Bacteria | 143938 |
| 50 | Ga0466715_409769 | 3300042616 | Bacteria | 4353 |
| 51 | Ga0466723_099232 | 3300042618 | Bacteria | 25745 |
| 52 | Ga0466723_253722 | 3300042618 | Bacteria | 5866 |
| 53 | Ga0466726_208315 | 3300042619 | Bacteria | 4896 |
| 54 | Ga0466705_126070 | 3300042612 | Bacteria | 23735 |
| 55 | Ga0466729_294411 | 3300042621 | Bacteria | 3660 |
| 56 | Ga0466729_315691 | 3300042621 | Bacteria | 6778 |
| 57 | Ga0466735_119856 | 3300042624 | Bacteria | 2508 |
| 58 | Ga0466735_170400 | 3300042624 | Bacteria | 3801 |
| 59 | Ga0466703_275746 | 3300042636 | Unclassified | 1969 |
| 60 | Ga0466703_330658 | 3300042636 | Bacteria | 3830 |
| 61 | Ga0466704_441958 | 3300042643 | Bacteria | 19981 |
| 62 | Ga0466709_153410 | 3300042648 | Bacteria | 3658 |
| 63 | Ga0466733_084099 | 3300042659 | Bacteria | 17407 |
| 64 | Ga0466733_170029 | 3300042659 | Bacteria | 24463 |
| 65 | Ga0123353_10356866 | 3300010167 | Bacteria | 2199 |
| 66 | Ga0466700_025451 | 3300042600 | Bacteria | 1783 |
| 67 | Ga0466707_008570 | 3300042601 | Bacteria | 3558 |
| 68 | Ga0466713_031005 | 3300042602 | Bacteria | 38195 |
| 69 | Ga0466713_108972 | 3300042602 | Bacteria | 12162 |
| 70 | Ga0466716_080023 | 3300042605 | Bacteria | 6444 |
| 71 | Ga0466716_428786 | 3300042605 | Bacteria | 3916 |
| 72 | Ga0466719_281613 | 3300042606 | Bacteria | 7571 |
| 73 | Ga0466698_492720 | 3300042610 | Bacteria | 1488 |
| 74 | Ga0466690_158768 | 3300042590 | Bacteria | 3351 |
| 75 | Ga0466690_231190 | 3300042590 | Bacteria | 2541 |
| 76 | Ga0466690_297132 | 3300042590 | Bacteria | 2890 |
| 77 | Ga0466690_384415 | 3300042590 | Bacteria | 23452 |
| 78 | Ga0466691_053951 | 3300042593 | Bacteria | 23010 |
| 79 | Ga0466696_048166 | 3300042596 | Bacteria | 14077 |
| 80 | Ga0466696_096383 | 3300042596 | Bacteria | 10587 |
| 81 | JGI24699J35502_11133981 | 3300002509 | Bacteria | 22510 |
| 82 | Ga0068302_10467062 | 3300005071 | Bacteria | 1485 |
| 83 | Ga0466711_020216 | 3300042615 | Bacteria | 9627 |
| 84 | Ga0466711_269619 | 3300042615 | Bacteria | 29361 |
| 85 | Ga0466715_157136 | 3300042616 | Bacteria | 21139 |
| 86 | Ga0466723_011686 | 3300042618 | Bacteria | 37097 |
| 87 | Ga0466726_218990 | 3300042619 | Bacteria | 1556 |
| 88 | Ga0466705_082487 | 3300042612 | Bacteria | 4311 |
| 89 | Ga0466705_253121 | 3300042612 | Unclassified | 2162 |
| 90 | Ga0466705_270858 | 3300042612 | Bacteria | 8495 |
| 91 | Ga0466735_036171 | 3300042624 | Bacteria | 2884 |
| 92 | Ga0466703_059408 | 3300042636 | Bacteria | 3330 |
| 93 | Ga0466703_214852 | 3300042636 | Bacteria | 7199 |
| 94 | Ga0466704_348442 | 3300042643 | Bacteria | 3036 |
| 95 | Ga0466709_021217 | 3300042648 | Bacteria | 24774 |
| 96 | Ga0466708_379717 | 3300042652 | Bacteria | 21213 |
| 97 | Ga0466727_111230 | 3300042655 | Bacteria | 11259 |
| 98 | Ga0123357_10055539 | 3300009784 | Bacteria | 5331 |
| 99 | Ga0123354_10006605 | 3300010882 | Bacteria | 17272 |
| 100 | Ga0466700_113382 | 3300042600 | Bacteria | 2086 |
| 101 | Ga0466707_124419 | 3300042601 | Bacteria | 18062 |
| 102 | Ga0466707_175485 | 3300042601 | Bacteria | 8599 |
| 103 | Ga0466707_225762 | 3300042601 | Bacteria | 3684 |
| 104 | Ga0466713_000398 | 3300042602 | Bacteria | 12002 |
| 105 | Ga0466713_029359 | 3300042602 | Bacteria | 15220 |
| 106 | Ga0466713_075457 | 3300042602 | Bacteria | 24128 |
| 107 | Ga0466713_081773 | 3300042602 | Bacteria | 94516 |
| 108 | Ga0466713_115952 | 3300042602 | Bacteria | 49145 |
| 109 | Ga0466713_119500 | 3300042602 | Bacteria | 16007 |
| 110 | Ga0466722_025343 | 3300042609 | Bacteria | 4043 |
| 111 | Ga0466690_030971 | 3300042590 | Bacteria | 20731 |
| 112 | Ga0466690_363966 | 3300042590 | Bacteria | 4057 |
| 113 | Ga0466690_379940 | 3300042590 | Bacteria | 10035 |
| 114 | Ga0466692_137050 | 3300042591 | Bacteria | 50701 |
| 115 | Ga0466691_124284 | 3300042593 | Bacteria | 8404 |
| 116 | Ga0466695_221931 | 3300042595 | Bacteria | 1913 |
| 117 | IMNBL1DRAFT_c0000891 | 3300000062 | Bacteria | 23227 |
| 118 | IMNBL1DRAFT_c0012940 | 3300000062 | Bacteria | 3780 |
| 119 | JGI24702J35022_10023656 | 3300002462 | Bacteria | 3321 |
| 120 | Ga0466718_169867 | 3300042617 | Bacteria | 1333 |
| 121 | Ga0466728_079520 | 3300042620 | Bacteria | 32961 |
| 122 | Ga0466728_115557 | 3300042620 | Bacteria | 8553 |
| 123 | Ga0466735_143879 | 3300042624 | Bacteria | 1097 |
| 124 | Ga0466703_029097 | 3300042636 | Bacteria | 2039 |
| 125 | Ga0466703_137946 | 3300042636 | Bacteria | 9402 |
| 126 | Ga0466703_234734 | 3300042636 | Bacteria | 21309 |
| 127 | Ga0466704_195560 | 3300042643 | Bacteria | 4704 |
| 128 | Ga0466708_090904 | 3300042652 | Bacteria | 64814 |
| 129 | Ga0466708_125186 | 3300042652 | Bacteria | 10347 |
| 130 | Ga0466727_041976 | 3300042655 | Bacteria | 33578 |
| 131 | Ga0466727_088613 | 3300042655 | Bacteria | 1386 |
| 132 | Ga0466701_098080 | 3300042598 | Bacteria | 65896 |
| 133 | Ga0466716_043422 | 3300042605 | Bacteria | 9090 |
| 134 | Ga0466716_315505 | 3300042605 | Bacteria | 4246 |
| 135 | Ga0466716_487123 | 3300042605 | Bacteria | 6582 |
| 136 | Ga0466719_150081 | 3300042606 | Bacteria | 16840 |
| 137 | Ga0466719_225743 | 3300042606 | Bacteria | 4817 |
| 138 | Ga0466696_252259 | 3300042596 | Bacteria | 1512 |
| 139 | Ga0068302_10008280 | 3300005071 | Bacteria | 3208 |
| 140 | Ga0466711_055733 | 3300042615 | Bacteria | 5707 |
| 141 | Ga0466711_290308 | 3300042615 | Bacteria | 7999 |
| 142 | Ga0466723_126378 | 3300042618 | Bacteria | 3436 |
| 143 | Ga0466726_025055 | 3300042619 | Bacteria | 1239 |
| 144 | Ga0466728_131950 | 3300042620 | Bacteria | 16045 |
| 145 | Ga0466697_083152 | 3300042611 | Bacteria | 2985 |
| 146 | Ga0466705_256948 | 3300042612 | Bacteria | 12533 |
| 147 | Ga0466735_087184 | 3300042624 | Bacteria | 3147 |
| 148 | Ga0466735_159155 | 3300042624 | Bacteria | 1047 |
| 149 | Ga0466730_000958 | 3300042625 | Bacteria | 2235 |
| 150 | Ga0466703_122371 | 3300042636 | Bacteria | 5922 |
| 151 | Ga0466704_009997 | 3300042643 | Bacteria | 2386 |
| 152 | Ga0466704_083849 | 3300042643 | Bacteria | 13312 |
| 153 | Ga0466704_108837 | 3300042643 | Bacteria | 11314 |
| 154 | Ga0466704_124104 | 3300042643 | Bacteria | 5190 |
| 155 | Ga0466709_337689 | 3300042648 | Bacteria | 10847 |
| 156 | Ga0466709_361644 | 3300042648 | Bacteria | 4333 |
| 157 | Ga0466725_161948 | 3300042654 | Bacteria | 6485 |
| 158 | Ga0466727_265855 | 3300042655 | Bacteria | 1583 |
| 159 | Ga0123357_10023339 | 3300009784 | Bacteria | 8310 |
| 160 | Ga0466700_174611 | 3300042600 | Bacteria | 29560 |
| 161 | Ga0466707_171476 | 3300042601 | Bacteria | 8721 |
| 162 | Ga0466713_028211 | 3300042602 | Bacteria | 3866 |
| 163 | Ga0466719_011482 | 3300042606 | Bacteria | 1718 |
| 164 | Ga0466722_212733 | 3300042609 | Bacteria | 11949 |
| 165 | Ga0466692_051866 | 3300042591 | Bacteria | 27413 |
| 166 | Ga0466691_016402 | 3300042593 | Bacteria | 4991 |
| 167 | Ga0466691_018901 | 3300042593 | Bacteria | 17257 |
| 168 | Ga0466696_244277 | 3300042596 | Bacteria | 1513 |
| 169 | 2227482984 | 2225789004 | Bacteria | 21557 |
| 170 | JGI24702J35022_10001907 | 3300002462 | Bacteria | 12835 |
| 171 | JGI24702J35022_10085129 | 3300002462 | Bacteria | 1716 |
| 172 | JGI24702J35022_10099383 | 3300002462 | Bacteria | 1591 |
| 173 | Ga0068302_10187657 | 3300005071 | Bacteria | 1414 |
| 174 | Ga0466715_254099 | 3300042616 | Bacteria | 2080 |
| 175 | Ga0466715_455852 | 3300042616 | Bacteria | 4665 |
| 176 | Ga0466726_219671 | 3300042619 | Bacteria | 11008 |
| 177 | Ga0466729_084596 | 3300042621 | Unclassified | 4430 |
| 178 | Ga0466735_043436 | 3300042624 | Bacteria | 3228 |
| 179 | Ga0466703_343665 | 3300042636 | Bacteria | 26612 |
| 180 | Ga0466704_304044 | 3300042643 | Bacteria | 3260 |
| 181 | Ga0466709_092371 | 3300042648 | Bacteria | 5976 |
| 182 | Ga0466727_288733 | 3300042655 | Bacteria | 11898 |
| 183 | Ga0466733_137450 | 3300042659 | Bacteria | 18606 |
| 184 | Ga0466733_184998 | 3300042659 | Bacteria | 1412 |
| 185 | Ga0123357_10121076 | 3300009784 | Bacteria | 3297 |
| 186 | Ga0123354_10008149 | 3300010882 | Bacteria | 15906 |
| 187 | Ga0466701_022627 | 3300042598 | Bacteria | 1542 |
| 188 | Ga0466707_314488 | 3300042601 | Bacteria | 1398 |
| 189 | Ga0466707_360986 | 3300042601 | Unclassified | 1445 |
| 190 | Ga0466713_101890 | 3300042602 | Bacteria | 2102 |
| 191 | Ga0466713_102313 | 3300042602 | Bacteria | 97036 |
| 192 | Ga0466716_316279 | 3300042605 | Bacteria | 3085 |
| 193 | Ga0466719_505082 | 3300042606 | Bacteria | 7036 |
| 194 | Ga0466690_131176 | 3300042590 | Bacteria | 21782 |
| 195 | Ga0466692_151072 | 3300042591 | Bacteria | 4613 |
| 196 | Ga0466691_000698 | 3300042593 | Bacteria | 35058 |
| 197 | Ga0466696_278891 | 3300042596 | Bacteria | 171866 |
| 198 | Ga0466696_326849 | 3300042596 | Bacteria | 9736 |
| 199 | Ga0466701_005522 | 3300042598 | Bacteria | 21003 |
| 200 | JGI24698J34947_10056336 | 3300002449 | Bacteria | 1955 |
| 201 | JGI24702J35022_10000952 | 3300002462 | Bacteria | 18056 |
| 202 | JGI24702J35022_10074742 | 3300002462 | Bacteria | 1829 |
| 203 | JGI24699J35502_11133753 | 3300002509 | Bacteria | 14839 |
| 204 | Ga0068305_10018327 | 3300005083 | Bacteria | 11298 |
| 205 | Ga0466711_146381 | 3300042615 | Bacteria | 6478 |
| 206 | Ga0466711_265686 | 3300042615 | Bacteria | 30446 |
| 207 | Ga0466711_422119 | 3300042615 | Bacteria | 1401 |
| 208 | Ga0466715_044201 | 3300042616 | Bacteria | 21603 |
| 209 | Ga0466715_085227 | 3300042616 | Bacteria | 7434 |
| 210 | Ga0466715_325706 | 3300042616 | Bacteria | 3768 |
| 211 | Ga0466726_365117 | 3300042619 | Bacteria | 5623 |
| 212 | Ga0466729_044479 | 3300042621 | Bacteria | 12266 |
| 213 | Ga0466705_279291 | 3300042612 | Bacteria | 6389 |
| 214 | Ga0466705_362479 | 3300042612 | Bacteria | 17994 |
| 215 | Ga0466705_378506 | 3300042612 | Bacteria | 4939 |
| 216 | Ga0466735_062063 | 3300042624 | Bacteria | 2700 |
| 217 | Ga0466735_117851 | 3300042624 | Bacteria | 1585 |
| 218 | Ga0466735_168381 | 3300042624 | Bacteria | 1399 |
| 219 | Ga0466703_196816 | 3300042636 | Bacteria | 3879 |
| 220 | Ga0466703_265869 | 3300042636 | Bacteria | 9977 |
| 221 | Ga0466704_006676 | 3300042643 | Bacteria | 13973 |
| 222 | Ga0466704_541758 | 3300042643 | Bacteria | 43707 |
| 223 | Ga0466704_592139 | 3300042643 | Bacteria | 2629 |
| 224 | Ga0123357_10203099 | 3300009784 | Bacteria | 2249 |
| 225 | Ga0123357_10211575 | 3300009784 | Bacteria | 2176 |
| 226 | Ga0123354_10270899 | 3300010882 | Bacteria | 1671 |
| 227 | Ga0466700_177310 | 3300042600 | Bacteria | 6314 |
| 228 | Ga0466707_106797 | 3300042601 | Bacteria | 6402 |
| 229 | Ga0466713_011150 | 3300042602 | Bacteria | 23658 |
| 230 | Ga0466716_112161 | 3300042605 | Bacteria | 19040 |
| 231 | Ga0466692_109685 | 3300042591 | Bacteria | 126606 |
| 232 | Ga0466696_038463 | 3300042596 | Bacteria | 3201 |
| 233 | Ga0466696_089824 | 3300042596 | Bacteria | 21768 |
| 234 | 2227065247 | 2225789003 | Unclassified | 3435 |
| 235 | 2227068581 | 2225789003 | Bacteria | 2948 |
| 236 | 2227464934 | 2225789004 | Bacteria | 5215 |
| 237 | 2227616283 | 2225789004 | Bacteria | 11886 |
| 238 | Ga0123357_10002550 | 3300009784 | Bacteria | 20413 |
| 239 | Ga0466705_502511 | 3300042612 | Bacteria | 10409 |
| 240 | Ga0466711_254369 | 3300042615 | Bacteria | 3448 |
| 241 | Ga0466711_273097 | 3300042615 | Bacteria | 19131 |
| 242 | Ga0466711_340063 | 3300042615 | Bacteria | 3838 |
| 243 | Ga0466711_365027 | 3300042615 | Bacteria | 17434 |
| 244 | Ga0466715_077474 | 3300042616 | Bacteria | 16543 |
| 245 | Ga0466715_133765 | 3300042616 | Unclassified | 2374 |
| 246 | Ga0466715_270340 | 3300042616 | Unclassified | 11644 |
| 247 | Ga0466715_638688 | 3300042616 | Bacteria | 40279 |
| 248 | Ga0466723_245376 | 3300042618 | Bacteria | 10412 |
| 249 | Ga0466726_098670 | 3300042619 | Bacteria | 1248 |
| 250 | Ga0466728_274036 | 3300042620 | Bacteria | 1399 |
| 251 | Ga0466735_112430 | 3300042624 | Bacteria | 1497 |
| 252 | Ga0466735_202631 | 3300042624 | Bacteria | 3609 |
| 253 | Ga0466702_140928 | 3300042635 | Bacteria | 1057 |
| 254 | Ga0466704_089358 | 3300042643 | Unclassified | 4152 |
| 255 | Ga0466704_446964 | 3300042643 | Bacteria | 4404 |
| 256 | Ga0466709_054036 | 3300042648 | Bacteria | 25368 |
| 257 | Ga0466709_229263 | 3300042648 | Bacteria | 21414 |
| 258 | Ga0466709_342866 | 3300042648 | Bacteria | 3294 |
| 259 | Ga0466708_094817 | 3300042652 | Bacteria | 3708 |
| 260 | Ga0466725_323744 | 3300042654 | Bacteria | 5770 |
| 261 | Ga0466727_286697 | 3300042655 | Bacteria | 18504 |
| 262 | Ga0466727_306595 | 3300042655 | Bacteria | 9088 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00800 | PDT | Prephenate dehydratase | 34 | 212 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.