Protein Family IF08205
Metagenome
Isolate
131
Members
38
Samples
129
Scaffolds
124.08
Avg Length
Representative Sequence
- ID
- 3300042619|Ga0466726_064478|Ga0466726_064478_269_709
- Length
- 141 aa
- Sequence
- MNLRRRKKNPWGESSASSDIAFLLIIAGFNINKGFLITLPAKNSQRLIQKDELLRFNLDRNGTLLFRGEISDLSAARLEIRSSIAEHPNLAVLLTVDPQTSWQRVVSFVELAQDLQVDSFSFVMGDAPPGGNLVSPPGGKP
Sample Types
Isolate
1.5%
Metagenome
98.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
36.1%
Termitidae
33.3%
Rhinotermitidae
11.1%
Termopsidae
11.1%
Unclassified
8.3%
Taxonomy
Archaea
0
Bacteria
119
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 2 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 3 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 4 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 5 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 6 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 7 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 8 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 9 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 10 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 11 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 12 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 13 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 14 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 15 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 16 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 17 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 18 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 19 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 20 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 21 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 22 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 23 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 24 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 25 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 26 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 27 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 28 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 29 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 30 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 31 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 32 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 33 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 34 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 35 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 36 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 37 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 38 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24698J34947_10002768 | 3300002449 | Bacteria | 9487 |
| 2 | JGI24698J34947_10010286 | 3300002449 | Bacteria | 5129 |
| 3 | JGI24698J34947_10039476 | 3300002449 | Bacteria | 2444 |
| 4 | Ga0466731_172212 | 3300042622 | Bacteria | 1548 |
| 5 | Ga0466735_194217 | 3300042624 | Bacteria | 7325 |
| 6 | Ga0466703_357634 | 3300042636 | Bacteria | 2575 |
| 7 | Ga0466703_372042 | 3300042636 | Bacteria | 1742 |
| 8 | Ga0466727_185760 | 3300042655 | Bacteria | 4590 |
| 9 | Ga0466707_396561 | 3300042601 | Bacteria | 1326 |
| 10 | Ga0466720_199737 | 3300042607 | Unclassified | 1370 |
| 11 | Ga0466722_240153 | 3300042609 | Bacteria | 1368 |
| 12 | Ga0466690_123309 | 3300042590 | Bacteria | 1251 |
| 13 | Ga0466690_200063 | 3300042590 | Bacteria | 2404 |
| 14 | Ga0466691_215554 | 3300042593 | Unclassified | 3037 |
| 15 | Ga0466694_132841 | 3300042594 | Bacteria | 23900 |
| 16 | Ga0466699_332337 | 3300042597 | Bacteria | 18397 |
| 17 | Ga0466712_046296 | 3300042614 | Bacteria | 40974 |
| 18 | Ga0466712_143378 | 3300042614 | Bacteria | 2225 |
| 19 | Ga0466711_209387 | 3300042615 | Bacteria | 1154 |
| 20 | Ga0466723_018216 | 3300042618 | Bacteria | 12679 |
| 21 | Ga0466726_064478 | 3300042619 | Bacteria | 1014 |
| 22 | Ga0466726_402823 | 3300042619 | Bacteria | 2750 |
| 23 | Ga0466705_323122 | 3300042612 | Bacteria | 4520 |
| 24 | Ga0466732_194709 | 3300042656 | Bacteria | 6501 |
| 25 | JGI24698J34947_10003840 | 3300002449 | Bacteria | 8176 |
| 26 | JGI24698J34947_10113353 | 3300002449 | Bacteria | 1192 |
| 27 | JGI24695J34938_10000410 | 3300002450 | Bacteria | 41829 |
| 28 | Ga0072941_1007286 | 3300005201 | Bacteria | 4846 |
| 29 | Ga0072941_1084964 | 3300005201 | Bacteria | 1161 |
| 30 | Ga0466727_332946 | 3300042655 | Bacteria | 3889 |
| 31 | Ga0466707_284923 | 3300042601 | Bacteria | 1058 |
| 32 | Ga0466716_351154 | 3300042605 | Bacteria | 1952 |
| 33 | Ga0466716_407415 | 3300042605 | Bacteria | 2105 |
| 34 | Ga0466690_237612 | 3300042590 | Bacteria | 14309 |
| 35 | Ga0466692_010239 | 3300042591 | Bacteria | 2410 |
| 36 | Ga0466692_019150 | 3300042591 | Bacteria | 17528 |
| 37 | Ga0466694_266204 | 3300042594 | Bacteria | 3187 |
| 38 | Ga0466712_033590 | 3300042614 | Bacteria | 12890 |
| 39 | Ga0466723_185601 | 3300042618 | Bacteria | 2219 |
| 40 | Ga0466723_211440 | 3300042618 | Bacteria | 5361 |
| 41 | Ga0466726_323914 | 3300042619 | Bacteria | 2084 |
| 42 | Ga0466705_279256 | 3300042612 | Bacteria | 5337 |
| 43 | JGI24698J34947_10002742 | 3300002449 | Bacteria | 9529 |
| 44 | JGI24698J34947_10126117 | 3300002449 | Bacteria | 1102 |
| 45 | JGI24698J34947_10169891 | 3300002449 | Bacteria | 884 |
| 46 | Ga0068302_10240233 | 3300005071 | Bacteria | 960 |
| 47 | Ga0466703_015238 | 3300042636 | Bacteria | 7629 |
| 48 | Ga0466703_071842 | 3300042636 | Bacteria | 6303 |
| 49 | Ga0466708_063124 | 3300042652 | Bacteria | 4803 |
| 50 | Ga0466727_016255 | 3300042655 | Unclassified | 2568 |
| 51 | Ga0466707_066010 | 3300042601 | Bacteria | 2851 |
| 52 | Ga0466719_406461 | 3300042606 | Bacteria | 9961 |
| 53 | Ga0466719_542079 | 3300042606 | Bacteria | 5041 |
| 54 | Ga0466722_060338 | 3300042609 | Bacteria | 3955 |
| 55 | Ga0466696_278448 | 3300042596 | Bacteria | 8016 |
| 56 | Ga0466712_275781 | 3300042614 | Unclassified | 2689 |
| 57 | Ga0466723_137752 | 3300042618 | Bacteria | 3839 |
| 58 | Ga0466726_286751 | 3300042619 | Unclassified | 1130 |
| 59 | Ga0074263_108949 | 3300005485 | Unclassified | 2027 |
| 60 | Ga0466729_270048 | 3300042621 | Bacteria | 1249 |
| 61 | Ga0466729_301441 | 3300042621 | Bacteria | 1641 |
| 62 | Ga0466735_165061 | 3300042624 | Bacteria | 1353 |
| 63 | Ga0466703_065518 | 3300042636 | Bacteria | 4690 |
| 64 | Ga0466703_214335 | 3300042636 | Bacteria | 2075 |
| 65 | Ga0466703_330858 | 3300042636 | Bacteria | 2210 |
| 66 | Ga0466708_000993 | 3300042652 | Bacteria | 2945 |
| 67 | Ga0466708_213574 | 3300042652 | Bacteria | 1913 |
| 68 | Ga0466727_049469 | 3300042655 | Bacteria | 3074 |
| 69 | Ga0466716_294298 | 3300042605 | Bacteria | 7274 |
| 70 | Ga0466696_422487 | 3300042596 | Bacteria | 18673 |
| 71 | Ga0466699_412812 | 3300042597 | Bacteria | 1255 |
| 72 | Ga0466712_197754 | 3300042614 | Bacteria | 1503 |
| 73 | Ga0466705_008890 | 3300042612 | Bacteria | 3189 |
| 74 | Ga0466729_210142 | 3300042621 | Bacteria | 1424 |
| 75 | Ga0466703_013709 | 3300042636 | Bacteria | 10298 |
| 76 | Ga0466703_027697 | 3300042636 | Unclassified | 5927 |
| 77 | Ga0466704_159602 | 3300042643 | Bacteria | 8954 |
| 78 | Ga0466709_387382 | 3300042648 | Bacteria | 2810 |
| 79 | Ga0466707_378974 | 3300042601 | Bacteria | 1360 |
| 80 | Ga0264413_116179 | 3300024493 | Bacteria | 12169 |
| 81 | Ga0466690_229276 | 3300042590 | Unclassified | 6991 |
| 82 | Ga0466690_366335 | 3300042590 | Bacteria | 1580 |
| 83 | Ga0466699_208000 | 3300042597 | Bacteria | 1935 |
| 84 | Ga0466711_141700 | 3300042615 | Bacteria | 16755 |
| 85 | Ga0466723_334300 | 3300042618 | Bacteria | 2304 |
| 86 | JGI24698J34947_10291285 | 3300002449 | Bacteria | 592 |
| 87 | Ga0466704_293555 | 3300042643 | Bacteria | 9705 |
| 88 | Ga0466704_329561 | 3300042643 | Bacteria | 6137 |
| 89 | Ga0466727_314450 | 3300042655 | Bacteria | 4898 |
| 90 | Ga0466719_060116 | 3300042606 | Bacteria | 1434 |
| 91 | Ga0466720_033754 | 3300042607 | Bacteria | 3056 |
| 92 | Ga0466720_044105 | 3300042607 | Bacteria | 31294 |
| 93 | Ga0264413_135757 | 3300024493 | Unclassified | 3954 |
| 94 | Ga0456237_0004000 | 3300041968 | Bacteria | 2373 |
| 95 | Ga0466692_170527 | 3300042591 | Bacteria | 2846 |
| 96 | Ga0466696_041549 | 3300042596 | Bacteria | 3817 |
| 97 | Ga0466715_083599 | 3300042616 | Bacteria | 2299 |
| 98 | Ga0466726_035843 | 3300042619 | Bacteria | 2397 |
| 99 | Ga0466726_436283 | 3300042619 | Bacteria | 1911 |
| 100 | Ga0466732_334512 | 3300042656 | Bacteria | 6314 |
| 101 | Ga0466732_410911 | 3300042656 | Bacteria | 11900 |
| 102 | JGI24698J34947_10002926 | 3300002449 | Bacteria | 9263 |
| 103 | JGI24698J34947_10009176 | 3300002449 | Bacteria | 5426 |
| 104 | JGI24698J34947_10048529 | 3300002449 | Bacteria | 2150 |
| 105 | Ga0466735_165498 | 3300042624 | Bacteria | 1243 |
| 106 | Ga0466702_398454 | 3300042635 | Bacteria | 1091 |
| 107 | Ga0466709_165759 | 3300042648 | Bacteria | 11561 |
| 108 | Ga0466727_262421 | 3300042655 | Bacteria | 11860 |
| 109 | Ga0466716_058420 | 3300042605 | Bacteria | 7283 |
| 110 | Ga0466720_123392 | 3300042607 | Unclassified | 1044 |
| 111 | Ga0466722_267773 | 3300042609 | Bacteria | 5300 |
| 112 | Ga0264413_116180 | 3300024493 | Bacteria | 6515 |
| 113 | Ga0466696_231629 | 3300042596 | Bacteria | 1502 |
| 114 | Ga0466705_529785 | 3300042612 | Bacteria | 4933 |
| 115 | Nasutiter_Contig21349 | 2030936001 | Unclassified | 1005 |
| 116 | JGI24698J34947_10002144 | 3300002449 | Bacteria | 10569 |
| 117 | JGI24698J34947_10063740 | 3300002449 | Bacteria | 1805 |
| 118 | JGI24698J34947_10069151 | 3300002449 | Unclassified | 1705 |
| 119 | Ga0072940_1139352 | 3300005200 | Bacteria | 857 |
| 120 | Ga0072941_1001886 | 3300005201 | Bacteria | 139305 |
| 121 | Ga0466704_129449 | 3300042643 | Bacteria | 13011 |
| 122 | Ga0466727_043079 | 3300042655 | Bacteria | 1714 |
| 123 | Ga0466727_286942 | 3300042655 | Bacteria | 1604 |
| 124 | Ga0466722_117358 | 3300042609 | Bacteria | 1513 |
| 125 | Ga0466691_097652 | 3300042593 | Bacteria | 19976 |
| 126 | Ga0466712_000858 | 3300042614 | Bacteria | 1198 |
| 127 | Ga0466711_300309 | 3300042615 | Bacteria | 27083 |
| 128 | Ga0466715_380960 | 3300042616 | Bacteria | 10027 |
| 129 | Ga0466726_461166 | 3300042619 | Bacteria | 3058 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02472 | ExbD | Biopolymer transport protein ExbD/TolR | 21 | 125 | 0.96 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.