Protein Family IF08197
Metagenome
Isolate
182
Members
36
Samples
181
Scaffolds
187.67
Avg Length
Representative Sequence
- ID
- 3300042619|Ga0466726_046087|Ga0466726_046087_8689_9324
- Length
- 211 aa
- Sequence
- MAPTIARWKSILPYSKEEHTVRIKYNAPTTLTFTFISAMVLILSLTLFQGLTGTWFAAPGRGSFNAGDIRCWITLFTHVLGHANLDHFLANFSFILLLGPILEANYGSRALFLMILITALVTGVLNVLFFPTGLLGASGVVFMMILLASFTNFSKGEIPLTFILILALYLGREIIDSFSSDDISQFAHIAGGFCGSLFGFFRPGKRVKLIE
Sample Types
Isolate
0.6%
Metagenome
99.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
40.0%
Termitidae
25.7%
Unclassified
11.4%
Rhinotermitidae
11.4%
Termopsidae
8.6%
Hodotermitidae
2.9%
Taxonomy
Archaea
2
Bacteria
171
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 2 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 3 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 4 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 5 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 6 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 7 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 8 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 9 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 10 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 11 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 12 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 13 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 14 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 15 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 16 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 17 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 18 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 19 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 20 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 21 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 22 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 23 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 24 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 25 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 26 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 27 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 28 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 29 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 30 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 31 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 32 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 33 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 34 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 35 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 36 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_083478 | 3300042612 | Bacteria | 9948 |
| 2 | Ga0466705_125691 | 3300042612 | Bacteria | 1658 |
| 3 | Ga0466707_256885 | 3300042601 | Bacteria | 1171 |
| 4 | Ga0466716_033862 | 3300042605 | Bacteria | 1699 |
| 5 | Ga0466716_073833 | 3300042605 | Bacteria | 4446 |
| 6 | Ga0466719_020160 | 3300042606 | Bacteria | 1258 |
| 7 | Ga0466719_066684 | 3300042606 | Bacteria | 1769 |
| 8 | Ga0466719_350740 | 3300042606 | Bacteria | 2142 |
| 9 | Ga0466722_263451 | 3300042609 | Bacteria | 3280 |
| 10 | Ga0466715_044394 | 3300042616 | Bacteria | 3809 |
| 11 | Ga0466715_632162 | 3300042616 | Bacteria | 2681 |
| 12 | Ga0466723_034759 | 3300042618 | Bacteria | 3499 |
| 13 | Ga0466723_130141 | 3300042618 | Bacteria | 92926 |
| 14 | Ga0466723_175764 | 3300042618 | Bacteria | 13311 |
| 15 | Ga0466723_214240 | 3300042618 | Bacteria | 1647 |
| 16 | Ga0466723_288268 | 3300042618 | Bacteria | 1719 |
| 17 | Ga0466729_123252 | 3300042621 | Bacteria | 1124 |
| 18 | Ga0123353_10575680 | 3300010167 | Bacteria | 1617 |
| 19 | Ga0466690_184108 | 3300042590 | Bacteria | 1790 |
| 20 | Ga0466691_048435 | 3300042593 | Bacteria | 5537 |
| 21 | Ga0466691_135133 | 3300042593 | Bacteria | 8653 |
| 22 | Ga0466691_171004 | 3300042593 | Bacteria | 1198 |
| 23 | Ga0466696_159501 | 3300042596 | Bacteria | 22033 |
| 24 | Ga0466703_090946 | 3300042636 | Bacteria | 4285 |
| 25 | Ga0466703_267467 | 3300042636 | Bacteria | 6641 |
| 26 | Ga0466704_251523 | 3300042643 | Unclassified | 1934 |
| 27 | Ga0466704_290702 | 3300042643 | Unclassified | 1479 |
| 28 | Ga0466709_096747 | 3300042648 | Bacteria | 11056 |
| 29 | Ga0072941_1010294 | 3300005201 | Bacteria | 8202 |
| 30 | Ga0072941_1132511 | 3300005201 | Bacteria | 3266 |
| 31 | Ga0466700_359541 | 3300042600 | Bacteria | 1591 |
| 32 | Ga0466716_020931 | 3300042605 | Bacteria | 2949 |
| 33 | Ga0466719_197195 | 3300042606 | Bacteria | 18174 |
| 34 | Ga0466722_097331 | 3300042609 | Bacteria | 79624 |
| 35 | Ga0466711_028605 | 3300042615 | Bacteria | 4749 |
| 36 | Ga0466715_286076 | 3300042616 | Bacteria | 13194 |
| 37 | Ga0466723_063651 | 3300042618 | Bacteria | 2437 |
| 38 | Ga0466723_141827 | 3300042618 | Bacteria | 6436 |
| 39 | Ga0466726_058371 | 3300042619 | Bacteria | 5691 |
| 40 | Ga0466726_174392 | 3300042619 | Bacteria | 2496 |
| 41 | Ga0466726_179225 | 3300042619 | Bacteria | 1943 |
| 42 | Ga0466726_288984 | 3300042619 | Bacteria | 1699 |
| 43 | Ga0466726_369544 | 3300042619 | Bacteria | 2174 |
| 44 | Ga0466726_390883 | 3300042619 | Bacteria | 1082 |
| 45 | Ga0466728_070228 | 3300042620 | Bacteria | 9479 |
| 46 | Ga0123356_10667037 | 3300010049 | Bacteria | 1208 |
| 47 | Ga0466692_114324 | 3300042591 | Bacteria | 3621 |
| 48 | Ga0466696_436905 | 3300042596 | Bacteria | 1674 |
| 49 | Ga0466735_051463 | 3300042624 | Bacteria | 1829 |
| 50 | Ga0466703_313476 | 3300042636 | Bacteria | 6145 |
| 51 | Ga0466708_166947 | 3300042652 | Bacteria | 1501 |
| 52 | Ga0466708_426950 | 3300042652 | Bacteria | 7079 |
| 53 | Ga0466727_295765 | 3300042655 | Bacteria | 2038 |
| 54 | JGI24702J35022_10050075 | 3300002462 | Bacteria | 2225 |
| 55 | Ga0466719_095899 | 3300042606 | Bacteria | 1998 |
| 56 | Ga0466719_287621 | 3300042606 | Bacteria | 2826 |
| 57 | Ga0466722_042213 | 3300042609 | Bacteria | 1238 |
| 58 | Ga0466722_097587 | 3300042609 | Bacteria | 9314 |
| 59 | Ga0466711_445439 | 3300042615 | Bacteria | 1776 |
| 60 | Ga0466711_476115 | 3300042615 | Bacteria | 3110 |
| 61 | Ga0466715_410680 | 3300042616 | Bacteria | 19869 |
| 62 | Ga0466715_507466 | 3300042616 | Bacteria | 30569 |
| 63 | Ga0466715_614332 | 3300042616 | Bacteria | 3875 |
| 64 | Ga0466723_086929 | 3300042618 | Bacteria | 10928 |
| 65 | Ga0466723_201950 | 3300042618 | Bacteria | 1414 |
| 66 | Ga0466726_463472 | 3300042619 | Bacteria | 1236 |
| 67 | Ga0466728_176519 | 3300042620 | Bacteria | 3822 |
| 68 | Ga0466728_180070 | 3300042620 | Bacteria | 4061 |
| 69 | Ga0466696_275546 | 3300042596 | Bacteria | 6019 |
| 70 | Ga0466735_163932 | 3300042624 | Bacteria | 1706 |
| 71 | Ga0466703_340924 | 3300042636 | Bacteria | 6462 |
| 72 | Ga0466709_144763 | 3300042648 | Bacteria | 1986 |
| 73 | Ga0466708_246361 | 3300042652 | Bacteria | 4207 |
| 74 | Ga0068305_10099312 | 3300005083 | Bacteria | 6448 |
| 75 | Ga0466705_150150 | 3300042612 | Bacteria | 2072 |
| 76 | Ga0466707_312572 | 3300042601 | Bacteria | 1126 |
| 77 | Ga0466716_185390 | 3300042605 | Bacteria | 27438 |
| 78 | Ga0466719_217662 | 3300042606 | Bacteria | 2370 |
| 79 | Ga0466719_368876 | 3300042606 | Bacteria | 1858 |
| 80 | Ga0466719_489372 | 3300042606 | Bacteria | 1832 |
| 81 | Ga0466711_274865 | 3300042615 | Bacteria | 2023 |
| 82 | Ga0466723_015073 | 3300042618 | Bacteria | 10697 |
| 83 | Ga0466723_095891 | 3300042618 | Bacteria | 3992 |
| 84 | Ga0466723_136893 | 3300042618 | Bacteria | 13309 |
| 85 | Ga0466726_046087 | 3300042619 | Bacteria | 14722 |
| 86 | Ga0466726_372677 | 3300042619 | Unclassified | 1370 |
| 87 | Ga0466726_413072 | 3300042619 | Bacteria | 3310 |
| 88 | Ga0466728_189538 | 3300042620 | Bacteria | 1998 |
| 89 | Ga0466729_111690 | 3300042621 | Bacteria | 2101 |
| 90 | Ga0123353_10407623 | 3300010167 | Bacteria | 2020 |
| 91 | Ga0123353_11005962 | 3300010167 | Bacteria | 1119 |
| 92 | Ga0466690_411763 | 3300042590 | Bacteria | 5328 |
| 93 | Ga0466692_193021 | 3300042591 | Bacteria | 1508 |
| 94 | Ga0466696_186459 | 3300042596 | Bacteria | 15541 |
| 95 | Ga0466734_048997 | 3300042623 | Bacteria | 1254 |
| 96 | Ga0466735_087041 | 3300042624 | Bacteria | 1740 |
| 97 | Ga0466703_009082 | 3300042636 | Bacteria | 7479 |
| 98 | Ga0466703_116357 | 3300042636 | Bacteria | 4709 |
| 99 | Ga0466704_024949 | 3300042643 | Bacteria | 10853 |
| 100 | Ga0466704_333509 | 3300042643 | Bacteria | 11297 |
| 101 | Ga0466709_148056 | 3300042648 | Bacteria | 27802 |
| 102 | Ga0466709_282835 | 3300042648 | Bacteria | 1254 |
| 103 | Ga0466708_002433 | 3300042652 | Bacteria | 2244 |
| 104 | Ga0466708_083268 | 3300042652 | Bacteria | 19719 |
| 105 | Ga0466708_125123 | 3300042652 | Bacteria | 2626 |
| 106 | Ga0466707_123168 | 3300042601 | Bacteria | 1864 |
| 107 | Ga0466719_045351 | 3300042606 | Bacteria | 5821 |
| 108 | Ga0466705_474930 | 3300042612 | Archaea | 2820 |
| 109 | Ga0466705_495037 | 3300042612 | Bacteria | 3822 |
| 110 | Ga0466715_174601 | 3300042616 | Bacteria | 6375 |
| 111 | Ga0466715_214076 | 3300042616 | Bacteria | 7674 |
| 112 | Ga0466723_326724 | 3300042618 | Bacteria | 5284 |
| 113 | Ga0466726_450955 | 3300042619 | Bacteria | 5534 |
| 114 | Ga0466728_231062 | 3300042620 | Bacteria | 10677 |
| 115 | Ga0466728_393830 | 3300042620 | Bacteria | 2110 |
| 116 | Ga0466728_444009 | 3300042620 | Unclassified | 6746 |
| 117 | Ga0466729_134072 | 3300042621 | Bacteria | 2999 |
| 118 | Ga0466690_215180 | 3300042590 | Bacteria | 1126 |
| 119 | Ga0466691_006311 | 3300042593 | Bacteria | 23417 |
| 120 | Ga0466696_382935 | 3300042596 | Bacteria | 1463 |
| 121 | Ga0466729_300555 | 3300042621 | Bacteria | 2561 |
| 122 | Ga0466703_026456 | 3300042636 | Bacteria | 8006 |
| 123 | Ga0466724_09030 | 3300042649 | Bacteria | 1851 |
| 124 | Ga0466708_106623 | 3300042652 | Bacteria | 34173 |
| 125 | Ga0466708_114067 | 3300042652 | Bacteria | 17228 |
| 126 | Ga0466705_050793 | 3300042612 | Bacteria | 9114 |
| 127 | Ga0466705_229708 | 3300042612 | Bacteria | 6129 |
| 128 | Ga0466706_026842 | 3300042599 | Bacteria | 2405 |
| 129 | Ga0466719_266835 | 3300042606 | Archaea | 3011 |
| 130 | Ga0466723_185267 | 3300042618 | Unclassified | 1492 |
| 131 | Ga0466726_216579 | 3300042619 | Bacteria | 9703 |
| 132 | Ga0466728_478907 | 3300042620 | Bacteria | 9355 |
| 133 | Ga0466690_272143 | 3300042590 | Bacteria | 3553 |
| 134 | Ga0466692_080931 | 3300042591 | Bacteria | 4054 |
| 135 | Ga0466735_227222 | 3300042624 | Bacteria | 2906 |
| 136 | Ga0466704_145291 | 3300042643 | Bacteria | 11527 |
| 137 | Ga0466704_229819 | 3300042643 | Bacteria | 2080 |
| 138 | Ga0466709_008582 | 3300042648 | Bacteria | 12282 |
| 139 | Ga0466709_338581 | 3300042648 | Bacteria | 14434 |
| 140 | Ga0466708_017857 | 3300042652 | Bacteria | 28268 |
| 141 | Ga0466708_088735 | 3300042652 | Bacteria | 5894 |
| 142 | Ga0466708_097815 | 3300042652 | Bacteria | 1281 |
| 143 | Ga0466708_438434 | 3300042652 | Unclassified | 1095 |
| 144 | Ga0466727_241679 | 3300042655 | Bacteria | 2336 |
| 145 | Ga0466707_157620 | 3300042601 | Bacteria | 2527 |
| 146 | Ga0466707_258116 | 3300042601 | Bacteria | 1058 |
| 147 | Ga0466716_045808 | 3300042605 | Bacteria | 4133 |
| 148 | Ga0466719_100930 | 3300042606 | Bacteria | 2678 |
| 149 | Ga0466719_162921 | 3300042606 | Unclassified | 2248 |
| 150 | Ga0466722_015308 | 3300042609 | Bacteria | 1511 |
| 151 | Ga0466697_020745 | 3300042611 | Bacteria | 3052 |
| 152 | Ga0466711_072605 | 3300042615 | Bacteria | 24965 |
| 153 | Ga0466711_401048 | 3300042615 | Bacteria | 13916 |
| 154 | Ga0466715_489354 | 3300042616 | Bacteria | 1113 |
| 155 | Ga0456237_0017691 | 3300041968 | Bacteria | 999 |
| 156 | Ga0466691_009760 | 3300042593 | Bacteria | 13422 |
| 157 | Ga0466696_062282 | 3300042596 | Bacteria | 24624 |
| 158 | Ga0466735_049982 | 3300042624 | Bacteria | 1785 |
| 159 | Ga0466703_119095 | 3300042636 | Bacteria | 16693 |
| 160 | Ga0466704_005646 | 3300042643 | Unclassified | 2908 |
| 161 | Ga0466704_622248 | 3300042643 | Bacteria | 1112 |
| 162 | Ga0466709_166132 | 3300042648 | Bacteria | 5359 |
| 163 | Ga0466709_269700 | 3300042648 | Bacteria | 4280 |
| 164 | Ga0466708_169710 | 3300042652 | Unclassified | 1156 |
| 165 | Ga0466707_373814 | 3300042601 | Bacteria | 5293 |
| 166 | Ga0466707_410983 | 3300042601 | Bacteria | 1106 |
| 167 | Ga0466713_068290 | 3300042602 | Bacteria | 4048 |
| 168 | Ga0466711_383156 | 3300042615 | Bacteria | 3810 |
| 169 | Ga0466715_365634 | 3300042616 | Bacteria | 10573 |
| 170 | Ga0466723_012635 | 3300042618 | Bacteria | 8096 |
| 171 | Ga0466728_360442 | 3300042620 | Bacteria | 2172 |
| 172 | Ga0466690_256633 | 3300042590 | Bacteria | 4560 |
| 173 | Ga0466692_099134 | 3300042591 | Bacteria | 1014 |
| 174 | Ga0466692_151433 | 3300042591 | Bacteria | 1142 |
| 175 | Ga0466691_037567 | 3300042593 | Bacteria | 3462 |
| 176 | Ga0466691_216751 | 3300042593 | Bacteria | 8245 |
| 177 | Ga0466694_131584 | 3300042594 | Bacteria | 8532 |
| 178 | Ga0466735_073363 | 3300042624 | Bacteria | 3333 |
| 179 | Ga0466704_078336 | 3300042643 | Bacteria | 2537 |
| 180 | Ga0466708_083426 | 3300042652 | Bacteria | 2055 |
| 181 | AustNasuHG_c1003589 | 3300000089 | Bacteria | 5603 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01694 | Rhomboid | Rhomboid family | 72 | 201 | 0.86 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.