Protein Family IF08190

Metagenome Isolate
148 Members
35 Samples
145 Scaffolds
332.16 Avg Length

🧬 Representative Sequence

ID
3300042619|Ga0466726_021884|Ga0466726_021884_325_1452
Length
365 aa
Sequence
MVQKRRVIRLIDAFSKLKFWKKFHIYIWRKVMKLTKILAAGLVILCAAAGVDFASGSAQKITIKVGDNWGATHPMAAALDNVFKPQIERNSNGAITVDVYHSGTLGNEGDLWNGVRNGTIEVAIVGTPMNQEYTTMMISDWPFLYRDIAHAKKVWTGPIAEEINTEFHQKFPTVYMIGWGPNSARTFTSNKKLTSVDDFKGQKFRMPANPIHVGIAENLGSSAQVIPLGELFSALETGVVDGQDNGMVTVISEAFYEVQKYVYETNHIIATLEIVVSAPFFDKLSADQQKIIKDAAKAASEKAWDDYIKSVDADRAFLRSKGVTVTPTSAADQQRIIQAIAPLTNSLYTQYSWAKPLTDRIKAVQ

📊 Sample Types

Isolate 2.0%
Metagenome 98.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 40.0%
Termitidae 20.0%
Unclassified 14.3%
Rhinotermitidae 11.4%
Termopsidae 11.4%
Hydrophilidae 2.9%

🌳 Taxonomy

Archaea 0
Bacteria 131
Eukaryota 0
Viruses 0
Unclassified 17

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
2 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
3 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
4 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
5 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
6 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
7 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
8 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
9 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
10 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
11 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
12 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
13 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
14 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
15 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
16 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
17 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
18 2873558832 Propioniciclava coleopterorum HDW11 Isolate Hydrophilidae
19 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
20 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
21 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
22 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
23 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
24 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
25 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
26 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
27 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
28 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
29 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
30 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
31 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
32 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
33 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
34 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
35 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_319447 3300042612 Unclassified 2550
2 Ga0466705_377226 3300042612 Bacteria 7062
3 Ga0466723_018431 3300042618 Bacteria 28448
4 Ga0466726_021884 3300042619 Bacteria 1535
5 Ga0466713_064416 3300042602 Bacteria 1449
6 Ga0466713_089920 3300042602 Bacteria 9923
7 Ga0466713_153447 3300042602 Bacteria 13421
8 Ga0466716_007259 3300042605 Bacteria 10179
9 Ga0466719_005857 3300042606 Bacteria 36913
10 Ga0466735_021958 3300042624 Bacteria 21027
11 Ga0466704_053676 3300042643 Bacteria 6473
12 Ga0466704_096627 3300042643 Bacteria 15992
13 Ga0466727_141679 3300042655 Bacteria 1941
14 Ga0466692_091174 3300042591 Bacteria 27969
15 Ga0466691_127948 3300042593 Bacteria 12354
16 Ga0466696_044016 3300042596 Unclassified 4678
17 Ga0466705_239953 3300042612 Bacteria 10560
18 Ga0466705_313464 3300042612 Bacteria 9869
19 Ga0466711_098444 3300042615 Bacteria 14523
20 Ga0466715_327646 3300042616 Bacteria 3466
21 Ga0466723_215514 3300042618 Bacteria 8004
22 Ga0466723_374586 3300042618 Bacteria 4772
23 Ga0466726_128814 3300042619 Bacteria 3525
24 Ga0466726_188654 3300042619 Unclassified 1983
25 Ga0466726_258018 3300042619 Bacteria 17950
26 Ga0466729_171627 3300042621 Bacteria 2559
27 Ga0466707_108311 3300042601 Bacteria 1874
28 Ga0466719_256408 3300042606 Unclassified 1551
29 Ga0466720_117543 3300042607 Bacteria 7574
30 Ga0466722_083234 3300042609 Bacteria 6969
31 Ga0466704_213146 3300042643 Bacteria 2254
32 Ga0466709_387528 3300042648 Bacteria 4268
33 Ga0466708_003193 3300042652 Bacteria 37391
34 Ga0466708_084403 3300042652 Unclassified 2977
35 Ga0466708_304358 3300042652 Bacteria 5948
36 Ga0466690_106996 3300042590 Bacteria 1495
37 Ga0466691_112097 3300042593 Bacteria 9820
38 Ga0466696_342277 3300042596 Bacteria 2623
39 Ga0068305_10000975 3300005083 Bacteria 96425
40 Ga0068305_10007931 3300005083 Bacteria 13543
41 Ga0466715_384297 3300042616 Bacteria 4381
42 Ga0466726_149481 3300042619 Bacteria 18773
43 Ga0466728_033970 3300042620 Bacteria 3342
44 Ga0466729_001943 3300042621 Bacteria 2419
45 Ga0466729_099295 3300042621 Bacteria 24355
46 Ga0466707_021573 3300042601 Bacteria 2805
47 Ga0466707_306106 3300042601 Bacteria 3294
48 Ga0466722_116548 3300042609 Bacteria 4424
49 Ga0466704_142697 3300042643 Unclassified 10475
50 Ga0466708_126727 3300042652 Bacteria 1423
51 Ga0466690_064754 3300042590 Bacteria 1411
52 Ga0466726_436338 3300042619 Bacteria 5186
53 Ga0466707_023894 3300042601 Bacteria 2125
54 Ga0466713_022763 3300042602 Unclassified 37805
55 Ga0466720_102658 3300042607 Bacteria 12726
56 Ga0466702_019837 3300042635 Bacteria 1211
57 Ga0466704_004257 3300042643 Bacteria 12334
58 Ga0466704_358934 3300042643 Bacteria 6493
59 Ga0466704_422042 3300042643 Bacteria 2461
60 Ga0466704_580379 3300042643 Bacteria 21505
61 Ga0466708_365390 3300042652 Bacteria 1648
62 Ga0466708_390509 3300042652 Bacteria 33782
63 Ga0466727_096329 3300042655 Unclassified 1263
64 Ga0456237_0012516 3300041968 Bacteria 1227
65 Ga0466691_207569 3300042593 Bacteria 29392
66 Ga0466705_077447 3300042612 Bacteria 9524
67 Ga0123355_10000286 3300009826 Bacteria 64768
68 Ga0466705_435776 3300042612 Unclassified 2057
69 Ga0466726_189386 3300042619 Bacteria 8848
70 Ga0466726_485470 3300042619 Bacteria 2399
71 Ga0466728_038065 3300042620 Bacteria 6050
72 Ga0466700_083233 3300042600 Bacteria 1336
73 Ga0466716_055836 3300042605 Bacteria 5000
74 Ga0466716_063579 3300042605 Unclassified 9230
75 Ga0466719_307829 3300042606 Bacteria 2636
76 Ga0466720_062328 3300042607 Bacteria 37859
77 Ga0466720_135280 3300042607 Bacteria 8575
78 Ga0466722_163820 3300042609 Bacteria 9719
79 Ga0466735_151060 3300042624 Bacteria 10879
80 Ga0466703_091276 3300042636 Bacteria 31362
81 Ga0466704_039441 3300042643 Bacteria 11354
82 Ga0466704_068349 3300042643 Bacteria 3364
83 Ga0466704_254872 3300042643 Bacteria 2193
84 Ga0466708_132282 3300042652 Bacteria 6460
85 Ga0466708_345058 3300042652 Bacteria 24070
86 Ga0466727_034133 3300042655 Bacteria 4937
87 Ga0466690_177058 3300042590 Unclassified 1137
88 Ga0466690_223947 3300042590 Unclassified 1666
89 Ga0466690_270404 3300042590 Bacteria 4549
90 Ga0466696_085464 3300042596 Bacteria 14961
91 Ga0068302_10206941 3300005071 Unclassified 3009
92 Ga0466705_047568 3300042612 Bacteria 2371
93 Ga0466705_127509 3300042612 Bacteria 10922
94 Ga0466705_382906 3300042612 Unclassified 2822
95 Ga0466726_276453 3300042619 Bacteria 8095
96 Ga0466728_307365 3300042620 Bacteria 8242
97 Ga0466707_104309 3300042601 Bacteria 2037
98 Ga0466716_253988 3300042605 Bacteria 3885
99 Ga0466722_034949 3300042609 Bacteria 37653
100 Ga0466735_069975 3300042624 Bacteria 1333
101 Ga0466703_154654 3300042636 Bacteria 4670
102 Ga0466703_167084 3300042636 Bacteria 1523
103 Ga0466704_481438 3300042643 Bacteria 9613
104 Ga0466690_267867 3300042590 Bacteria 4541
105 Ga0466696_123046 3300042596 Bacteria 3761
106 JGI24700J35501_10928528 3300002508 Bacteria 7768
107 Ga0466715_193095 3300042616 Bacteria 3662
108 Ga0466715_392342 3300042616 Bacteria 63693
109 Ga0466726_388795 3300042619 Bacteria 2428
110 Ga0466716_007985 3300042605 Bacteria 13976
111 Ga0466716_177791 3300042605 Bacteria 8650
112 Ga0466716_272428 3300042605 Bacteria 3371
113 Ga0466720_010335 3300042607 Unclassified 1889
114 Ga0466735_051963 3300042624 Bacteria 7937
115 Ga0466703_226192 3300042636 Bacteria 63543
116 Ga0466704_179318 3300042643 Bacteria 2631
117 Ga0466727_128002 3300042655 Bacteria 2543
118 Ga0466727_284524 3300042655 Bacteria 1291
119 Ga0466690_025897 3300042590 Bacteria 5994
120 Ga0466692_015702 3300042591 Bacteria 16528
121 Ga0466692_180379 3300042591 Bacteria 16329
122 Ga0466696_050693 3300042596 Bacteria 4427
123 Ga0466696_199495 3300042596 Bacteria 4145
124 Ga0466696_317852 3300042596 Bacteria 5056
125 Ga0466733_185413 3300042659 Bacteria 1120
126 Ga0466723_082530 3300042618 Bacteria 1798
127 Ga0466723_171642 3300042618 Bacteria 7718
128 Ga0466726_195527 3300042619 Bacteria 9277
129 Ga0466726_400574 3300042619 Bacteria 12909
130 Ga0466728_093000 3300042620 Bacteria 34506
131 Ga0466728_315512 3300042620 Bacteria 15460
132 Ga0466719_345012 3300042606 Bacteria 23330
133 Ga0466720_144650 3300042607 Bacteria 2342
134 Ga0466708_047184 3300042652 Bacteria 5711
135 Ga0466727_077107 3300042655 Bacteria 3632
136 Ga0466727_140776 3300042655 Bacteria 2028
137 Ga0466727_319744 3300042655 Bacteria 4343
138 Ga0466690_040451 3300042590 Bacteria 3554
139 Ga0466690_104487 3300042590 Unclassified 1140
140 Ga0466690_315045 3300042590 Unclassified 4499
141 Ga0466690_415058 3300042590 Bacteria 1581
142 Ga0466691_002305 3300042593 Bacteria 3439
143 Ga0466696_011998 3300042596 Bacteria 2210
144 Ga0466696_141327 3300042596 Bacteria 1868
145 Ga0466699_253793 3300042597 Bacteria 4685

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03480 DctP Bacterial extracellular solute-binding protein, family 7 66 348 0.97

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF03480 GO:0055085 transmembrane transport BP

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.