Protein Family IF08144
Metagenome
Isolate
149
Members
37
Samples
146
Scaffolds
271.9
Avg Length
Representative Sequence
- ID
- 3300042618|Ga0466723_272925|Ga0466723_272925_721_1659
- Length
- 312 aa
- Sequence
- VNHNRAKIFTFRVWIFPQNPVSFEKALEKAVCPAFSRRLRENGMENYRISEDRIVHYDCRRLRGDFPLDGDLEKPVWKQAERTRRFVDMVSGDPAPLNTRAAALWDEKALYVAYWIDEPDVRASFTERDSLVWFDNDVEFFIDGQDCYYEFEINAFNTVYEVFFVYQDALKKGSRFDREEFDLYRRDVDVLGGFQDAARFRKHRRGRRWAFMDFDFPGLQSGVKIDGKINDPSHIDKGWTVELAFPWEGFRILSPGKNFPPQEGDRIRCQFFRFENLRANGKALASAGWALNEHGVYDSHIPENFAYLHFRD
Sample Types
Isolate
2.0%
Metagenome
98.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
38.9%
Termitidae
33.3%
Rhinotermitidae
11.1%
Termopsidae
8.3%
Unclassified
5.6%
Blaberidae
2.8%
Taxonomy
Archaea
0
Bacteria
144
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 2 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 3 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 4 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 5 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 13 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 14 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 15 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 16 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 17 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 18 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 19 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 20 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 21 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 22 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 23 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 24 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 25 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 26 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 27 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 28 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 29 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 30 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 31 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 32 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 33 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 34 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 35 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 36 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 37 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_053348 | 3300042659 | Bacteria | 3263 |
| 2 | Ga0123355_10180883 | 3300009826 | Bacteria | 3129 |
| 3 | Ga0466705_403659 | 3300042612 | Bacteria | 3307 |
| 4 | Ga0466715_519331 | 3300042616 | Bacteria | 16528 |
| 5 | Ga0466729_009704 | 3300042621 | Unclassified | 1120 |
| 6 | Ga0466705_179186 | 3300042612 | Bacteria | 2375 |
| 7 | Ga0466703_186324 | 3300042636 | Bacteria | 5472 |
| 8 | Ga0415639_053088 | 3300038395 | Bacteria | 2041 |
| 9 | Ga0456237_0006149 | 3300041968 | Bacteria | 1890 |
| 10 | Ga0466691_168690 | 3300042593 | Bacteria | 17792 |
| 11 | Ga0466696_009578 | 3300042596 | Bacteria | 18246 |
| 12 | Ga0123353_10065396 | 3300010167 | Bacteria | 5838 |
| 13 | Ga0466705_504173 | 3300042612 | Bacteria | 3545 |
| 14 | Ga0466723_044534 | 3300042618 | Bacteria | 19776 |
| 15 | Ga0466723_060774 | 3300042618 | Bacteria | 10759 |
| 16 | Ga0466723_254503 | 3300042618 | Bacteria | 6569 |
| 17 | Ga0466719_092679 | 3300042606 | Bacteria | 14546 |
| 18 | Ga0466722_042405 | 3300042609 | Bacteria | 4672 |
| 19 | Ga0466698_344065 | 3300042610 | Bacteria | 1745 |
| 20 | Ga0466705_038948 | 3300042612 | Bacteria | 1834 |
| 21 | Ga0466703_143438 | 3300042636 | Bacteria | 5772 |
| 22 | Ga0466703_215869 | 3300042636 | Bacteria | 12150 |
| 23 | Ga0466704_134585 | 3300042643 | Bacteria | 7424 |
| 24 | Ga0466704_346146 | 3300042643 | Bacteria | 7951 |
| 25 | Ga0466708_145853 | 3300042652 | Bacteria | 3082 |
| 26 | Ga0456237_0000628 | 3300041968 | Bacteria | 5390 |
| 27 | Ga0466690_312799 | 3300042590 | Bacteria | 6554 |
| 28 | Ga0466690_392329 | 3300042590 | Bacteria | 2327 |
| 29 | Ga0466690_412849 | 3300042590 | Bacteria | 2120 |
| 30 | Ga0466691_120542 | 3300042593 | Bacteria | 13825 |
| 31 | Ga0466694_104147 | 3300042594 | Bacteria | 1969 |
| 32 | Ga0466694_358738 | 3300042594 | Bacteria | 5162 |
| 33 | Ga0466696_348793 | 3300042596 | Bacteria | 13791 |
| 34 | Ga0466696_411545 | 3300042596 | Bacteria | 1038 |
| 35 | Ga0123354_10252669 | 3300010882 | Bacteria | 1781 |
| 36 | JGI24702J35022_10071157 | 3300002462 | Bacteria | 1873 |
| 37 | Ga0466723_207707 | 3300042618 | Bacteria | 18495 |
| 38 | Ga0466726_302915 | 3300042619 | Unclassified | 1045 |
| 39 | Ga0466726_426785 | 3300042619 | Bacteria | 5990 |
| 40 | Ga0466728_101966 | 3300042620 | Bacteria | 40822 |
| 41 | Ga0466728_173618 | 3300042620 | Bacteria | 1754 |
| 42 | Ga0466716_516063 | 3300042605 | Bacteria | 3053 |
| 43 | Ga0466719_048211 | 3300042606 | Bacteria | 1701 |
| 44 | Ga0466705_059765 | 3300042612 | Unclassified | 4417 |
| 45 | Ga0466705_241949 | 3300042612 | Bacteria | 6317 |
| 46 | Ga0466735_204109 | 3300042624 | Bacteria | 1215 |
| 47 | Ga0466703_155123 | 3300042636 | Bacteria | 31361 |
| 48 | Ga0466709_330967 | 3300042648 | Bacteria | 4517 |
| 49 | Ga0456237_0000773 | 3300041968 | Bacteria | 4962 |
| 50 | Ga0466691_059826 | 3300042593 | Bacteria | 8383 |
| 51 | Ga0466696_365953 | 3300042596 | Bacteria | 1176 |
| 52 | Ga0466733_087227 | 3300042659 | Bacteria | 24839 |
| 53 | Ga0466733_221681 | 3300042659 | Bacteria | 2473 |
| 54 | Ga0466715_130934 | 3300042616 | Bacteria | 8052 |
| 55 | Ga0466723_186276 | 3300042618 | Bacteria | 11225 |
| 56 | Ga0466726_242115 | 3300042619 | Bacteria | 4009 |
| 57 | Ga0466728_204335 | 3300042620 | Bacteria | 3924 |
| 58 | Ga0466716_052145 | 3300042605 | Bacteria | 22754 |
| 59 | Ga0466719_513067 | 3300042606 | Bacteria | 2034 |
| 60 | Ga0466722_031644 | 3300042609 | Bacteria | 5394 |
| 61 | Ga0466722_126749 | 3300042609 | Bacteria | 12883 |
| 62 | Ga0466698_363138 | 3300042610 | Bacteria | 2402 |
| 63 | Ga0466705_213817 | 3300042612 | Bacteria | 34329 |
| 64 | Ga0466735_084135 | 3300042624 | Bacteria | 9229 |
| 65 | Ga0466735_173989 | 3300042624 | Bacteria | 4078 |
| 66 | Ga0466704_242768 | 3300042643 | Unclassified | 2433 |
| 67 | Ga0466704_356334 | 3300042643 | Bacteria | 58812 |
| 68 | Ga0466708_338235 | 3300042652 | Bacteria | 21831 |
| 69 | Ga0466727_104409 | 3300042655 | Bacteria | 1671 |
| 70 | Ga0466690_283388 | 3300042590 | Bacteria | 14677 |
| 71 | Ga0466692_082160 | 3300042591 | Bacteria | 31423 |
| 72 | Ga0466696_261079 | 3300042596 | Bacteria | 2719 |
| 73 | Ga0123357_10256201 | 3300009784 | Bacteria | 1860 |
| 74 | Ga0123353_10254403 | 3300010167 | Bacteria | 2717 |
| 75 | Ga0466715_008950 | 3300042616 | Bacteria | 4569 |
| 76 | Ga0466726_342859 | 3300042619 | Bacteria | 3260 |
| 77 | Ga0466726_369074 | 3300042619 | Bacteria | 2164 |
| 78 | Ga0466728_070483 | 3300042620 | Bacteria | 6643 |
| 79 | Ga0466728_145894 | 3300042620 | Bacteria | 7236 |
| 80 | Ga0466705_278397 | 3300042612 | Bacteria | 14446 |
| 81 | Ga0466703_039700 | 3300042636 | Bacteria | 2995 |
| 82 | Ga0466709_155428 | 3300042648 | Bacteria | 1243 |
| 83 | Ga0466708_177919 | 3300042652 | Bacteria | 2411 |
| 84 | Ga0466690_006781 | 3300042590 | Bacteria | 2770 |
| 85 | Ga0466690_189794 | 3300042590 | Unclassified | 2591 |
| 86 | Ga0466696_029803 | 3300042596 | Bacteria | 25127 |
| 87 | Ga0123353_10111074 | 3300010167 | Bacteria | 4415 |
| 88 | Ga0072941_1118958 | 3300005201 | Bacteria | 1812 |
| 89 | Ga0466715_272677 | 3300042616 | Bacteria | 29328 |
| 90 | Ga0466723_149854 | 3300042618 | Bacteria | 25559 |
| 91 | Ga0466726_141949 | 3300042619 | Bacteria | 2306 |
| 92 | Ga0466722_040736 | 3300042609 | Bacteria | 50466 |
| 93 | Ga0466722_229630 | 3300042609 | Bacteria | 4862 |
| 94 | Ga0466705_106731 | 3300042612 | Bacteria | 8264 |
| 95 | Ga0466705_243330 | 3300042612 | Bacteria | 12481 |
| 96 | Ga0466729_245309 | 3300042621 | Bacteria | 1442 |
| 97 | Ga0466731_292443 | 3300042622 | Bacteria | 1069 |
| 98 | Ga0466735_080112 | 3300042624 | Bacteria | 2267 |
| 99 | Ga0466703_148604 | 3300042636 | Bacteria | 6211 |
| 100 | Ga0466704_589266 | 3300042643 | Bacteria | 6317 |
| 101 | Ga0466708_059682 | 3300042652 | Bacteria | 15983 |
| 102 | Ga0466708_125287 | 3300042652 | Bacteria | 13791 |
| 103 | Ga0466690_068746 | 3300042590 | Bacteria | 5772 |
| 104 | Ga0466692_033692 | 3300042591 | Bacteria | 2716 |
| 105 | JGI24702J35022_10003623 | 3300002462 | Bacteria | 9307 |
| 106 | JGI24702J35022_10074147 | 3300002462 | Bacteria | 1836 |
| 107 | Ga0466711_377525 | 3300042615 | Bacteria | 26138 |
| 108 | Ga0466715_046988 | 3300042616 | Bacteria | 2813 |
| 109 | Ga0466715_550875 | 3300042616 | Bacteria | 48407 |
| 110 | Ga0466723_272925 | 3300042618 | Bacteria | 3500 |
| 111 | Ga0466723_282644 | 3300042618 | Bacteria | 5427 |
| 112 | Ga0466726_139571 | 3300042619 | Bacteria | 1038 |
| 113 | Ga0466726_255203 | 3300042619 | Bacteria | 26043 |
| 114 | Ga0466728_168784 | 3300042620 | Bacteria | 2986 |
| 115 | Ga0466728_262744 | 3300042620 | Bacteria | 9756 |
| 116 | Ga0466716_078458 | 3300042605 | Bacteria | 10129 |
| 117 | Ga0466722_084383 | 3300042609 | Bacteria | 2611 |
| 118 | Ga0466703_263074 | 3300042636 | Bacteria | 2508 |
| 119 | Ga0466704_070859 | 3300042643 | Bacteria | 3416 |
| 120 | Ga0466690_416695 | 3300042590 | Bacteria | 4599 |
| 121 | Ga0466692_061168 | 3300042591 | Bacteria | 10540 |
| 122 | Ga0466696_175252 | 3300042596 | Bacteria | 19404 |
| 123 | Ga0466696_400817 | 3300042596 | Bacteria | 15586 |
| 124 | Ga0123354_10275490 | 3300010882 | Bacteria | 1646 |
| 125 | AustNasuHG_c1025826 | 3300000089 | Bacteria | 1840 |
| 126 | Ga0466712_062193 | 3300042614 | Bacteria | 12566 |
| 127 | Ga0466712_109000 | 3300042614 | Bacteria | 1663 |
| 128 | Ga0466711_116791 | 3300042615 | Bacteria | 63127 |
| 129 | Ga0466726_393732 | 3300042619 | Bacteria | 10654 |
| 130 | Ga0466716_282659 | 3300042605 | Bacteria | 1235 |
| 131 | Ga0466719_010450 | 3300042606 | Bacteria | 11674 |
| 132 | Ga0466719_050994 | 3300042606 | Bacteria | 4536 |
| 133 | Ga0466719_215304 | 3300042606 | Bacteria | 3620 |
| 134 | Ga0466722_150664 | 3300042609 | Bacteria | 25191 |
| 135 | Ga0466705_296642 | 3300042612 | Bacteria | 4126 |
| 136 | Ga0466703_062398 | 3300042636 | Bacteria | 3711 |
| 137 | Ga0466703_067661 | 3300042636 | Bacteria | 15749 |
| 138 | Ga0466703_324669 | 3300042636 | Bacteria | 5122 |
| 139 | Ga0466703_335496 | 3300042636 | Bacteria | 6257 |
| 140 | Ga0466704_378085 | 3300042643 | Bacteria | 22325 |
| 141 | Ga0466709_121454 | 3300042648 | Bacteria | 7160 |
| 142 | Ga0466708_223123 | 3300042652 | Bacteria | 1528 |
| 143 | Ga0466727_001566 | 3300042655 | Bacteria | 11761 |
| 144 | Ga0415639_078126 | 3300038395 | Bacteria | 1008 |
| 145 | Ga0466694_109529 | 3300042594 | Bacteria | 2956 |
| 146 | Ga0466696_393402 | 3300042596 | Bacteria | 2107 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.