Protein Family IF08141
Metagenome
Metatranscriptome
Isolate
193
Members
45
Samples
167
Scaffolds
116.69
Avg Length
Representative Sequence
- ID
- 3300042618|Ga0466723_267941|Ga0466723_267941_5686_6060
- Length
- 124 aa
- Sequence
- MKKIEAIIRKTRFDEVKEALIIADIEWFSYSEVRGVGKDREERIYRGIVYDTSSIERIQLSIIVRDKNVEKAVDAIQKAAYTGEIGDGRIFILPAEDAISIRSGKRGDATLFISDENNNNSIKK
Sample Types
Isolate
8.8%
Metagenome
90.7%
MAG
0.0%
Metatranscriptome
0.5%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
29.5%
Unclassified
18.2%
Blattidae
15.9%
Rhinotermitidae
11.4%
Termopsidae
9.1%
Hydrophilidae
4.5%
Termitidae
4.5%
Passalidae
4.5%
Hodotermitidae
2.3%
Taxonomy
Archaea
0
Bacteria
161
Eukaryota
0
Viruses
0
Unclassified
32
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 2 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 3 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 4 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 12 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 13 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 14 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 15 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 16 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 17 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 18 | 3300021235 | Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA | Metatranscriptome | |
| 19 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 20 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 21 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 22 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 23 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 24 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 25 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 26 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 27 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 28 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 29 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 30 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 31 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 32 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 33 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 34 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 35 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 36 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 37 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 38 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 39 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 40 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 41 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 42 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 43 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 44 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 45 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466713_013341 | 3300042602 | Bacteria | 9141 |
| 2 | Ga0466722_052131 | 3300042609 | Bacteria | 3076 |
| 3 | Ga0466722_153098 | 3300042609 | Bacteria | 6795 |
| 4 | Ga0466692_100330 | 3300042591 | Bacteria | 10292 |
| 5 | Ga0466692_184435 | 3300042591 | Bacteria | 106081 |
| 6 | Ga0466691_075403 | 3300042593 | Unclassified | 5479 |
| 7 | Ga0466705_432372 | 3300042612 | Bacteria | 25685 |
| 8 | Ga0466711_279280 | 3300042615 | Bacteria | 5327 |
| 9 | Ga0466735_146317 | 3300042624 | Unclassified | 3115 |
| 10 | Ga0466735_226779 | 3300042624 | Bacteria | 4140 |
| 11 | Ga0466703_180644 | 3300042636 | Bacteria | 6548 |
| 12 | Ga0466704_377599 | 3300042643 | Unclassified | 2388 |
| 13 | Ga0466708_014146 | 3300042652 | Bacteria | 33245 |
| 14 | Ga0466727_276854 | 3300042655 | Bacteria | 1407 |
| 15 | Ga0466733_035084 | 3300042659 | Bacteria | 1865 |
| 16 | Ga0466733_141151 | 3300042659 | Bacteria | 35707 |
| 17 | Ga0466706_015316 | 3300042599 | Bacteria | 50470 |
| 18 | Ga0466707_220928 | 3300042601 | Unclassified | 1689 |
| 19 | Ga0466713_051288 | 3300042602 | Bacteria | 230715 |
| 20 | Ga0466713_102957 | 3300042602 | Bacteria | 7684 |
| 21 | Ga0466713_122699 | 3300042602 | Bacteria | 14819 |
| 22 | Ga0466716_204215 | 3300042605 | Bacteria | 10305 |
| 23 | Ga0466719_012860 | 3300042606 | Bacteria | 5072 |
| 24 | Ga0466722_211216 | 3300042609 | Bacteria | 13417 |
| 25 | Ga0466691_119991 | 3300042593 | Bacteria | 41422 |
| 26 | Ga0466705_150677 | 3300042612 | Unclassified | 2092 |
| 27 | Ga0466705_340457 | 3300042612 | Bacteria | 13208 |
| 28 | Ga0466715_231415 | 3300042616 | Bacteria | 17252 |
| 29 | Ga0466726_225863 | 3300042619 | Bacteria | 4699 |
| 30 | Ga0466735_166713 | 3300042624 | Bacteria | 4860 |
| 31 | Ga0466703_118325 | 3300042636 | Unclassified | 14098 |
| 32 | Ga0466703_359248 | 3300042636 | Bacteria | 1491 |
| 33 | Ga0466704_030571 | 3300042643 | Bacteria | 29418 |
| 34 | Ga0466704_080805 | 3300042643 | Unclassified | 1628 |
| 35 | Ga0466704_166435 | 3300042643 | Bacteria | 3492 |
| 36 | Ga0466704_243211 | 3300042643 | Unclassified | 1318 |
| 37 | Ga0466727_322521 | 3300042655 | Unclassified | 2262 |
| 38 | Ga0466707_108820 | 3300042601 | Unclassified | 3011 |
| 39 | Ga0466713_026737 | 3300042602 | Unclassified | 1894 |
| 40 | Ga0466713_041439 | 3300042602 | Bacteria | 39210 |
| 41 | Ga0466722_031342 | 3300042609 | Unclassified | 6324 |
| 42 | IMNBGM34_c000157 | 3300000036 | Bacteria | 20273 |
| 43 | Ga0466692_041376 | 3300042591 | Bacteria | 3499 |
| 44 | Ga0466711_512613 | 3300042615 | Bacteria | 1653 |
| 45 | Ga0466726_012239 | 3300042619 | Bacteria | 5298 |
| 46 | Ga0466726_202919 | 3300042619 | Bacteria | 7961 |
| 47 | Ga0466735_073387 | 3300042624 | Bacteria | 1290 |
| 48 | Ga0466735_077103 | 3300042624 | Bacteria | 12471 |
| 49 | Ga0466735_112747 | 3300042624 | Bacteria | 1966 |
| 50 | Ga0466703_018918 | 3300042636 | Bacteria | 11941 |
| 51 | Ga0466703_205741 | 3300042636 | Bacteria | 6987 |
| 52 | Ga0466703_425127 | 3300042636 | Bacteria | 2660 |
| 53 | Ga0466704_112725 | 3300042643 | Bacteria | 6257 |
| 54 | Ga0466704_325766 | 3300042643 | Bacteria | 11167 |
| 55 | Ga0466713_123374 | 3300042602 | Bacteria | 2776 |
| 56 | Ga0466722_221597 | 3300042609 | Bacteria | 1123 |
| 57 | Ga0068302_10059694 | 3300005071 | Unclassified | 2360 |
| 58 | Ga0466690_150757 | 3300042590 | Bacteria | 28046 |
| 59 | Ga0466690_323128 | 3300042590 | Bacteria | 11614 |
| 60 | Ga0466705_116639 | 3300042612 | Bacteria | 4177 |
| 61 | Ga0466705_128515 | 3300042612 | Bacteria | 6075 |
| 62 | Ga0466711_289238 | 3300042615 | Bacteria | 45865 |
| 63 | Ga0466715_166869 | 3300042616 | Bacteria | 16654 |
| 64 | Ga0466715_645617 | 3300042616 | Bacteria | 18531 |
| 65 | Ga0466723_182800 | 3300042618 | Bacteria | 17816 |
| 66 | Ga0466723_332954 | 3300042618 | Bacteria | 7235 |
| 67 | Ga0466735_055025 | 3300042624 | Unclassified | 1645 |
| 68 | Ga0466735_082395 | 3300042624 | Bacteria | 2089 |
| 69 | Ga0466703_010326 | 3300042636 | Unclassified | 5140 |
| 70 | Ga0466703_224076 | 3300042636 | Bacteria | 4068 |
| 71 | Ga0466703_273645 | 3300042636 | Unclassified | 3389 |
| 72 | Ga0466704_135473 | 3300042643 | Unclassified | 8956 |
| 73 | Ga0466704_168057 | 3300042643 | Bacteria | 9719 |
| 74 | Ga0466704_186547 | 3300042643 | Bacteria | 9429 |
| 75 | Ga0466709_419438 | 3300042648 | Bacteria | 66983 |
| 76 | Ga0466727_138214 | 3300042655 | Unclassified | 2048 |
| 77 | Ga0466733_027595 | 3300042659 | Bacteria | 96004 |
| 78 | Ga0466707_348055 | 3300042601 | Bacteria | 31580 |
| 79 | Ga0466713_016416 | 3300042602 | Bacteria | 19610 |
| 80 | Ga0466713_077243 | 3300042602 | Bacteria | 6396 |
| 81 | Ga0466713_139646 | 3300042602 | Bacteria | 516516 |
| 82 | Ga0466719_009247 | 3300042606 | Bacteria | 1002 |
| 83 | Ga0466719_119841 | 3300042606 | Bacteria | 10986 |
| 84 | Ga0466720_216564 | 3300042607 | Bacteria | 1145 |
| 85 | Ga0068305_10764748 | 3300005083 | Unclassified | 1011 |
| 86 | Ga0466690_041954 | 3300042590 | Bacteria | 29614 |
| 87 | Ga0466690_313309 | 3300042590 | Bacteria | 6166 |
| 88 | Ga0466692_066954 | 3300042591 | Bacteria | 2210 |
| 89 | Ga0466691_026998 | 3300042593 | Bacteria | 4945 |
| 90 | Ga0466691_060058 | 3300042593 | Bacteria | 6144 |
| 91 | Ga0466691_137054 | 3300042593 | Bacteria | 3642 |
| 92 | Ga0466696_316300 | 3300042596 | Unclassified | 1563 |
| 93 | Ga0466711_044228 | 3300042615 | Bacteria | 17400 |
| 94 | Ga0466715_020463 | 3300042616 | Bacteria | 4732 |
| 95 | Ga0466715_105279 | 3300042616 | Bacteria | 1963 |
| 96 | Ga0466723_120006 | 3300042618 | Bacteria | 38480 |
| 97 | Ga0466726_246231 | 3300042619 | Bacteria | 12013 |
| 98 | Ga0466726_344762 | 3300042619 | Bacteria | 2456 |
| 99 | Ga0466729_237705 | 3300042621 | Unclassified | 3145 |
| 100 | Ga0466729_293249 | 3300042621 | Bacteria | 3631 |
| 101 | Ga0466709_105232 | 3300042648 | Bacteria | 6508 |
| 102 | Ga0466727_103024 | 3300042655 | Bacteria | 46807 |
| 103 | Ga0466727_225049 | 3300042655 | Bacteria | 48864 |
| 104 | Ga0466707_293813 | 3300042601 | Unclassified | 1015 |
| 105 | Ga0466707_310430 | 3300042601 | Bacteria | 4509 |
| 106 | Ga0466719_158226 | 3300042606 | Bacteria | 3145 |
| 107 | Ga0466719_181388 | 3300042606 | Bacteria | 3095 |
| 108 | Ga0466719_454816 | 3300042606 | Bacteria | 2785 |
| 109 | Ga0466692_008872 | 3300042591 | Bacteria | 29437 |
| 110 | Ga0466691_200204 | 3300042593 | Bacteria | 12641 |
| 111 | Ga0466711_184071 | 3300042615 | Bacteria | 34370 |
| 112 | Ga0466715_091139 | 3300042616 | Bacteria | 3322 |
| 113 | Ga0466729_181885 | 3300042621 | Unclassified | 1219 |
| 114 | Ga0466729_188834 | 3300042621 | Unclassified | 3255 |
| 115 | Ga0466735_071539 | 3300042624 | Unclassified | 3009 |
| 116 | Ga0466735_123948 | 3300042624 | Bacteria | 2094 |
| 117 | Ga0466703_068563 | 3300042636 | Bacteria | 7859 |
| 118 | Ga0466703_223013 | 3300042636 | Bacteria | 1042 |
| 119 | Ga0466703_338372 | 3300042636 | Bacteria | 3808 |
| 120 | Ga0466704_153356 | 3300042643 | Unclassified | 17466 |
| 121 | Ga0466704_497510 | 3300042643 | Bacteria | 27766 |
| 122 | Ga0466709_115133 | 3300042648 | Bacteria | 48629 |
| 123 | Ga0466708_165144 | 3300042652 | Bacteria | 12423 |
| 124 | Ga0466727_167554 | 3300042655 | Unclassified | 3017 |
| 125 | Ga0466707_083127 | 3300042601 | Bacteria | 12863 |
| 126 | Ga0466707_196494 | 3300042601 | Unclassified | 8252 |
| 127 | Ga0466707_312551 | 3300042601 | Bacteria | 1656 |
| 128 | Ga0466707_320570 | 3300042601 | Bacteria | 1609 |
| 129 | Ga0466707_340473 | 3300042601 | Bacteria | 5522 |
| 130 | Ga0466707_413440 | 3300042601 | Bacteria | 7130 |
| 131 | Ga0466719_207981 | 3300042606 | Unclassified | 1238 |
| 132 | IMNBL1DRAFT_c0043605 | 3300000062 | Bacteria | 1483 |
| 133 | Ga0466690_170447 | 3300042590 | Bacteria | 7092 |
| 134 | Ga0466690_213257 | 3300042590 | Bacteria | 57182 |
| 135 | Ga0466690_422035 | 3300042590 | Unclassified | 2613 |
| 136 | Ga0466711_153559 | 3300042615 | Bacteria | 12942 |
| 137 | Ga0466715_525564 | 3300042616 | Bacteria | 5451 |
| 138 | Ga0466723_121407 | 3300042618 | Bacteria | 7313 |
| 139 | Ga0466723_267941 | 3300042618 | Bacteria | 9742 |
| 140 | Ga0466726_085488 | 3300042619 | Bacteria | 11240 |
| 141 | Ga0466729_028783 | 3300042621 | Bacteria | 2393 |
| 142 | Ga0466735_002543 | 3300042624 | Bacteria | 1640 |
| 143 | Ga0466703_113593 | 3300042636 | Bacteria | 10196 |
| 144 | Ga0466703_160018 | 3300042636 | Bacteria | 7927 |
| 145 | Ga0466704_595134 | 3300042643 | Bacteria | 13438 |
| 146 | Ga0466708_221865 | 3300042652 | Bacteria | 8654 |
| 147 | Ga0466707_008034 | 3300042601 | Bacteria | 12113 |
| 148 | Ga0466707_012249 | 3300042601 | Bacteria | 25629 |
| 149 | Ga0466707_024216 | 3300042601 | Bacteria | 1716 |
| 150 | Ga0466707_085726 | 3300042601 | Bacteria | 6618 |
| 151 | Ga0466713_008762 | 3300042602 | Bacteria | 34128 |
| 152 | Ga0466713_031582 | 3300042602 | Bacteria | 8307 |
| 153 | Ga0466719_568256 | 3300042606 | Bacteria | 5499 |
| 154 | Ga0223674_1132099 | 3300021235 | Bacteria | 540 |
| 155 | Ga0466690_052554 | 3300042590 | Bacteria | 22844 |
| 156 | Ga0466692_103080 | 3300042591 | Unclassified | 1765 |
| 157 | Ga0466692_106145 | 3300042591 | Unclassified | 2180 |
| 158 | Ga0466691_052407 | 3300042593 | Bacteria | 9734 |
| 159 | Ga0466715_234297 | 3300042616 | Bacteria | 23273 |
| 160 | Ga0466715_601574 | 3300042616 | Bacteria | 17986 |
| 161 | Ga0466726_152329 | 3300042619 | Bacteria | 1108 |
| 162 | Ga0466735_002918 | 3300042624 | Bacteria | 5433 |
| 163 | Ga0466735_065878 | 3300042624 | Bacteria | 6025 |
| 164 | Ga0466703_093887 | 3300042636 | Bacteria | 3484 |
| 165 | Ga0466703_293817 | 3300042636 | Bacteria | 2611 |
| 166 | Ga0466703_338499 | 3300042636 | Bacteria | 2240 |
| 167 | Ga0466727_265933 | 3300042655 | Bacteria | 1705 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00543 | P-II | Nitrogen regulatory protein P-II | 1 | 105 | 0.94 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.