Protein Family IF08120
Metagenome
Isolate
155
Members
47
Samples
148
Scaffolds
229.28
Avg Length
Representative Sequence
- ID
- 3300042618|Ga0466723_214031|Ga0466723_214031_104_940
- Length
- 278 aa
- Sequence
- MPVSLLDRKLRAFVPIVLSAFPSRPVSPKMVAETGGDVYTVNMTRGILIAGNGSSLCAAIEAEIARRVKHFTLALIPNRLPGSTNSAADAFSEKTSPPSGHEARIPLVWNPGSPVSARTLVIAAENRLEHINEAILICSPPSVRRAAAELAPGDIEIMVNDHIKGWFYLVKELAAVFRARRAGSLALVFSETGPGGGRDDAADILGPAALASFRAFTQSVLASALNEPYQTMAFSSSEAGAEAAFAAFIVKQLDEGNKRSNGKWHRFGKLNLFGRLPR
Sample Types
Isolate
4.5%
Metagenome
95.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
42.2%
Kalotermitidae
31.1%
Unclassified
15.6%
Termopsidae
6.7%
Rhinotermitidae
4.4%
Taxonomy
Archaea
0
Bacteria
145
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 2 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 3 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 7 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 8 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 9 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 10 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 11 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 12 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 13 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 14 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 15 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 16 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 17 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 18 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 19 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 20 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 21 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 22 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 23 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 24 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 25 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 26 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 27 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 28 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 29 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 30 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 31 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 32 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 33 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 34 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 35 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 36 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 37 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 38 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 39 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 40 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 41 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 42 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 43 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 44 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 45 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 46 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 47 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466707_182588 | 3300042601 | Bacteria | 3129 |
| 2 | Ga0466720_089305 | 3300042607 | Bacteria | 26279 |
| 3 | Ga0466722_250853 | 3300042609 | Bacteria | 2951 |
| 4 | Ga0466705_493591 | 3300042612 | Bacteria | 8868 |
| 5 | Ga0466718_149924 | 3300042617 | Bacteria | 2804 |
| 6 | Ga0466726_446928 | 3300042619 | Bacteria | 2226 |
| 7 | Ga0264413_114559 | 3300024493 | Bacteria | 1504 |
| 8 | Ga0466690_370030 | 3300042590 | Bacteria | 1474 |
| 9 | Ga0466691_099306 | 3300042593 | Bacteria | 9231 |
| 10 | Ga0466696_335197 | 3300042596 | Bacteria | 35443 |
| 11 | Ga0466707_060702 | 3300042601 | Bacteria | 1117 |
| 12 | Ga0466719_331021 | 3300042606 | Bacteria | 12140 |
| 13 | Ga0466720_049532 | 3300042607 | Bacteria | 16419 |
| 14 | Ga0466722_146764 | 3300042609 | Bacteria | 1708 |
| 15 | Ga0466715_149946 | 3300042616 | Bacteria | 9129 |
| 16 | Ga0466715_462355 | 3300042616 | Bacteria | 6348 |
| 17 | Ga0264413_119507 | 3300024493 | Bacteria | 2808 |
| 18 | Ga0466692_028229 | 3300042591 | Bacteria | 2594 |
| 19 | Ga0466735_193858 | 3300042624 | Bacteria | 1193 |
| 20 | Ga0466735_208325 | 3300042624 | Bacteria | 2057 |
| 21 | Ga0466703_114433 | 3300042636 | Bacteria | 25250 |
| 22 | Ga0466704_085505 | 3300042643 | Bacteria | 3115 |
| 23 | Ga0466704_105401 | 3300042643 | Bacteria | 16631 |
| 24 | Ga0466704_221950 | 3300042643 | Bacteria | 12708 |
| 25 | Ga0466709_278652 | 3300042648 | Bacteria | 4877 |
| 26 | AustNasuHG_c1054669 | 3300000089 | Unclassified | 819 |
| 27 | JGI24698J34947_10012297 | 3300002449 | Bacteria | 4690 |
| 28 | Ga0466705_006996 | 3300042612 | Bacteria | 7384 |
| 29 | Ga0466732_026046 | 3300042656 | Bacteria | 5488 |
| 30 | Ga0466720_008029 | 3300042607 | Bacteria | 1802 |
| 31 | Ga0466720_060354 | 3300042607 | Bacteria | 7733 |
| 32 | Ga0466720_149902 | 3300042607 | Bacteria | 23595 |
| 33 | Ga0466712_036241 | 3300042614 | Unclassified | 4493 |
| 34 | Ga0466712_110702 | 3300042614 | Unclassified | 6062 |
| 35 | Ga0466718_037729 | 3300042617 | Bacteria | 1098 |
| 36 | Ga0466728_463947 | 3300042620 | Bacteria | 5979 |
| 37 | Ga0466691_102083 | 3300042593 | Bacteria | 3301 |
| 38 | Ga0466694_063558 | 3300042594 | Bacteria | 34055 |
| 39 | Ga0466694_166355 | 3300042594 | Bacteria | 109748 |
| 40 | Ga0466735_074594 | 3300042624 | Bacteria | 2724 |
| 41 | Ga0466702_218870 | 3300042635 | Bacteria | 2621 |
| 42 | Ga0466702_324209 | 3300042635 | Bacteria | 11014 |
| 43 | Ga0466704_469199 | 3300042643 | Bacteria | 10867 |
| 44 | Ga0466709_036911 | 3300042648 | Bacteria | 6422 |
| 45 | Ga0466709_383443 | 3300042648 | Bacteria | 5520 |
| 46 | Ga0466708_351943 | 3300042652 | Bacteria | 4342 |
| 47 | AustNasuHG_c1026297 | 3300000089 | Bacteria | 1814 |
| 48 | JGI24695J34938_10000369 | 3300002450 | Bacteria | 44536 |
| 49 | Ga0466707_295821 | 3300042601 | Bacteria | 5048 |
| 50 | Ga0466716_267744 | 3300042605 | Bacteria | 1642 |
| 51 | Ga0466719_076717 | 3300042606 | Bacteria | 18973 |
| 52 | Ga0466720_039028 | 3300042607 | Unclassified | 8481 |
| 53 | Ga0466720_062105 | 3300042607 | Bacteria | 20445 |
| 54 | Ga0466721_191339 | 3300042608 | Bacteria | 79638 |
| 55 | Ga0466715_116608 | 3300042616 | Bacteria | 2665 |
| 56 | Ga0466735_044275 | 3300042624 | Bacteria | 1437 |
| 57 | Ga0466703_023240 | 3300042636 | Bacteria | 3748 |
| 58 | Ga0466703_152392 | 3300042636 | Bacteria | 4932 |
| 59 | Ga0466704_080929 | 3300042643 | Bacteria | 7592 |
| 60 | Ga0466708_050622 | 3300042652 | Bacteria | 3979 |
| 61 | AustNasuHG_c1000124 | 3300000089 | Bacteria | 23612 |
| 62 | AustNasuHG_c1001079 | 3300000089 | Bacteria | 9787 |
| 63 | AustNasuHG_c1009194 | 3300000089 | Bacteria | 3475 |
| 64 | Ga0068302_10140289 | 3300005071 | Bacteria | 1745 |
| 65 | Ga0072940_1083888 | 3300005200 | Bacteria | 1867 |
| 66 | Ga0466705_059342 | 3300042612 | Bacteria | 8583 |
| 67 | Ga0466705_156097 | 3300042612 | Bacteria | 1900 |
| 68 | Ga0466732_257077 | 3300042656 | Bacteria | 1759 |
| 69 | Ga0466733_067829 | 3300042659 | Bacteria | 52214 |
| 70 | Ga0466707_378333 | 3300042601 | Bacteria | 2619 |
| 71 | Ga0466719_322581 | 3300042606 | Bacteria | 2152 |
| 72 | Ga0466720_008850 | 3300042607 | Bacteria | 13895 |
| 73 | Ga0466722_082630 | 3300042609 | Bacteria | 4277 |
| 74 | Ga0466711_272301 | 3300042615 | Unclassified | 1273 |
| 75 | Ga0466715_518779 | 3300042616 | Bacteria | 13891 |
| 76 | Ga0466718_100759 | 3300042617 | Bacteria | 9859 |
| 77 | Ga0466723_098489 | 3300042618 | Bacteria | 1825 |
| 78 | Ga0466723_214031 | 3300042618 | Bacteria | 5701 |
| 79 | Ga0466728_211325 | 3300042620 | Bacteria | 2239 |
| 80 | Ga0123356_10009736 | 3300010049 | Bacteria | 9473 |
| 81 | Ga0466703_204244 | 3300042636 | Bacteria | 2932 |
| 82 | Ga0466704_161582 | 3300042643 | Bacteria | 9235 |
| 83 | Ga0466704_363378 | 3300042643 | Bacteria | 6622 |
| 84 | Ga0466708_095269 | 3300042652 | Bacteria | 23314 |
| 85 | Ga0466708_354221 | 3300042652 | Bacteria | 5388 |
| 86 | JGI24700J35501_10929298 | 3300002508 | Bacteria | 8992 |
| 87 | Ga0466732_134604 | 3300042656 | Bacteria | 32211 |
| 88 | Ga0466707_009568 | 3300042601 | Bacteria | 18472 |
| 89 | Ga0466719_125599 | 3300042606 | Bacteria | 2366 |
| 90 | Ga0466720_037794 | 3300042607 | Bacteria | 2327 |
| 91 | Ga0466720_140465 | 3300042607 | Bacteria | 33994 |
| 92 | Ga0466721_089995 | 3300042608 | Bacteria | 1502 |
| 93 | Ga0466722_164709 | 3300042609 | Bacteria | 1970 |
| 94 | Ga0466718_017957 | 3300042617 | Bacteria | 5255 |
| 95 | Ga0466718_148333 | 3300042617 | Bacteria | 1961 |
| 96 | Ga0466723_099592 | 3300042618 | Bacteria | 2901 |
| 97 | Ga0123356_10460933 | 3300010049 | Bacteria | 1421 |
| 98 | Ga0264413_109836 | 3300024493 | Bacteria | 6419 |
| 99 | Ga0415639_005755 | 3300038395 | Bacteria | 14243 |
| 100 | Ga0466657_286143 | 3300042582 | Unclassified | 1741 |
| 101 | Ga0466691_026337 | 3300042593 | Bacteria | 4567 |
| 102 | Ga0466696_358939 | 3300042596 | Bacteria | 9447 |
| 103 | Ga0466709_150278 | 3300042648 | Bacteria | 2550 |
| 104 | JGI24695J34938_10013157 | 3300002450 | Bacteria | 4356 |
| 105 | Ga0072941_1036567 | 3300005201 | Bacteria | 7109 |
| 106 | Ga0074263_101482 | 3300005485 | Bacteria | 2441 |
| 107 | Ga0466705_108466 | 3300042612 | Bacteria | 4232 |
| 108 | Ga0466705_319684 | 3300042612 | Bacteria | 1274 |
| 109 | Ga0466719_240468 | 3300042606 | Bacteria | 11454 |
| 110 | Ga0466720_082573 | 3300042607 | Unclassified | 8384 |
| 111 | Ga0466722_004336 | 3300042609 | Bacteria | 2911 |
| 112 | Ga0466711_123858 | 3300042615 | Bacteria | 8835 |
| 113 | Ga0466715_199087 | 3300042616 | Bacteria | 2648 |
| 114 | Ga0466715_480954 | 3300042616 | Bacteria | 9685 |
| 115 | Ga0466718_005186 | 3300042617 | Bacteria | 3835 |
| 116 | Ga0123355_10223478 | 3300009826 | Bacteria | 2703 |
| 117 | Ga0123353_10010397 | 3300010167 | Bacteria | 12969 |
| 118 | Ga0264413_103394 | 3300024493 | Bacteria | 29703 |
| 119 | Ga0466704_060382 | 3300042643 | Bacteria | 33102 |
| 120 | Ga0466704_553727 | 3300042643 | Bacteria | 10426 |
| 121 | Ga0466709_105159 | 3300042648 | Bacteria | 2079 |
| 122 | AustNasuHG_c1017153 | 3300000089 | Bacteria | 2412 |
| 123 | JGI24698J34947_10014510 | 3300002449 | Bacteria | 4290 |
| 124 | JGI24695J34938_10001354 | 3300002450 | Bacteria | 21183 |
| 125 | JGI24695J34938_10012204 | 3300002450 | Bacteria | 4572 |
| 126 | Ga0072941_1007171 | 3300005201 | Bacteria | 1192 |
| 127 | Ga0074263_108093 | 3300005485 | Unclassified | 1541 |
| 128 | Ga0466705_123140 | 3300042612 | Unclassified | 7647 |
| 129 | Ga0466732_164744 | 3300042656 | Bacteria | 2026 |
| 130 | Ga0466716_316129 | 3300042605 | Bacteria | 1692 |
| 131 | Ga0466719_203915 | 3300042606 | Bacteria | 5191 |
| 132 | Ga0466720_043305 | 3300042607 | Bacteria | 11476 |
| 133 | Ga0466720_179504 | 3300042607 | Bacteria | 13268 |
| 134 | Ga0466722_216131 | 3300042609 | Bacteria | 2372 |
| 135 | Ga0466711_340078 | 3300042615 | Bacteria | 2106 |
| 136 | Ga0466715_353571 | 3300042616 | Bacteria | 3200 |
| 137 | Ga0466718_024458 | 3300042617 | Bacteria | 1840 |
| 138 | Ga0466726_082421 | 3300042619 | Bacteria | 6500 |
| 139 | Ga0466728_344929 | 3300042620 | Bacteria | 7425 |
| 140 | Ga0264413_145808 | 3300024493 | Bacteria | 1280 |
| 141 | Ga0466690_152434 | 3300042590 | Bacteria | 4145 |
| 142 | Ga0466692_200136 | 3300042591 | Bacteria | 1441 |
| 143 | Ga0466694_201107 | 3300042594 | Bacteria | 1223 |
| 144 | Ga0466696_034301 | 3300042596 | Bacteria | 10376 |
| 145 | Ga0466703_415772 | 3300042636 | Bacteria | 16052 |
| 146 | Ga0466708_009809 | 3300042652 | Bacteria | 1193 |
| 147 | Ga0466708_110398 | 3300042652 | Unclassified | 1654 |
| 148 | Ga0466708_174708 | 3300042652 | Bacteria | 7695 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.