Protein Family IF08118
Metagenome
Isolate
174
Members
51
Samples
164
Scaffolds
346.5
Avg Length
Representative Sequence
- ID
- 3300042618|Ga0466723_211719|Ga0466723_211719_550_1692
- Length
- 380 aa
- Sequence
- MFTSTFIISPNKRIGGIGMASNVYFSDMAYTAYEADQTLPRKLDRQLAASGLGEKVKDKNVAIKIHVGAEIGYSTIPPVFLRILAGFVKDHGGNCFFVDHYIAARHPEHRGYTQDSLGAPVLEAAGHLGKYLYTVDVDYKSFKHVDIAGLVYDADFLINFAHVKGHGCCAYGGAVKNIAMGCVSDRTRREQHGLEGGLKWEAKDCIHCNACVESCNHQANSFNDKGEYEVNFHNCTLCQHCLKVCPAGAIISTGSSYLDFQQGLALCTKTVLDSFEPGNVFYINLLISITAMCDCWGMTTPSLVPDIGLMSSWDLAAIESASLDQIRYERLNPEGVPTGITLGEKGHLFERLHGKDPYAQIRFIEDFSLGSRDYALEKIN
Sample Types
Isolate
5.8%
Metagenome
94.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
33.3%
Kalotermitidae
27.5%
Unclassified
23.5%
Termopsidae
5.9%
Passalidae
3.9%
Rhinotermitidae
3.9%
Hodotermitidae
2.0%
Taxonomy
Archaea
0
Bacteria
160
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 2 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 3 | 2820336130 | Unclassified Firmicutes Nt197P3bin70 | Isolate | Unclassified |
| 4 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 5 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 6 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 7 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 8 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 9 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 10 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 11 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 12 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 13 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 14 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 15 | 2820427814 | Unclassified Firmicutes Lab288P3bin44 | Isolate | Unclassified |
| 16 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 17 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 18 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 19 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 20 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 21 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 22 | 2820362221 | Unclassified Firmicutes Nt197P3bin116 | Isolate | Unclassified |
| 23 | 2820464928 | Unclassified Firmicutes Lab288P3bin121 | Isolate | Unclassified |
| 24 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 25 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 26 | 2820389254 | Unclassified Firmicutes Nc150P4bin19 | Isolate | Unclassified |
| 27 | 2820551407 | Unclassified Firmicutes Emb289P4bin38 | Isolate | Unclassified |
| 28 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 29 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 30 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 31 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 32 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 33 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 34 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 35 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 36 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 37 | 2820414148 | Unclassified Firmicutes Lab288P3bin93 | Isolate | Unclassified |
| 38 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 39 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 40 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 41 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 42 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 43 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 44 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 45 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 46 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 47 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 48 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 49 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 50 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 51 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_232317 | 3300042612 | Bacteria | 3001 |
| 2 | Ga0123353_10956473 | 3300010167 | Bacteria | 1158 |
| 3 | Ga0466707_102500 | 3300042601 | Bacteria | 4329 |
| 4 | Ga0466707_107775 | 3300042601 | Bacteria | 1460 |
| 5 | Ga0466719_472684 | 3300042606 | Bacteria | 1726 |
| 6 | Ga0466722_240244 | 3300042609 | Bacteria | 16563 |
| 7 | Ga0466735_000128 | 3300042624 | Bacteria | 12772 |
| 8 | Ga0466709_247353 | 3300042648 | Bacteria | 3887 |
| 9 | Ga0466708_251611 | 3300042652 | Bacteria | 11598 |
| 10 | Ga0466727_297846 | 3300042655 | Bacteria | 1410 |
| 11 | IMNBL1DRAFT_c0000029 | 3300000062 | Bacteria | 131956 |
| 12 | Ga0123357_10000472 | 3300009784 | Bacteria | 39208 |
| 13 | Ga0466711_213166 | 3300042615 | Bacteria | 5829 |
| 14 | Ga0466711_262404 | 3300042615 | Bacteria | 2224 |
| 15 | Ga0466715_019846 | 3300042616 | Bacteria | 9596 |
| 16 | Ga0466723_116394 | 3300042618 | Bacteria | 1423 |
| 17 | Ga0466723_143127 | 3300042618 | Bacteria | 3594 |
| 18 | Ga0466705_105498 | 3300042612 | Bacteria | 1528 |
| 19 | Ga0466733_123921 | 3300042659 | Bacteria | 1892 |
| 20 | Ga0466691_041421 | 3300042593 | Bacteria | 12427 |
| 21 | Ga0466691_153707 | 3300042593 | Bacteria | 13524 |
| 22 | Ga0123357_10200106 | 3300009784 | Bacteria | 2276 |
| 23 | Ga0123356_10441529 | 3300010049 | Bacteria | 1448 |
| 24 | Ga0123353_10054045 | 3300010167 | Bacteria | 6420 |
| 25 | Ga0123353_10271557 | 3300010167 | Unclassified | 2612 |
| 26 | Ga0466706_143462 | 3300042599 | Bacteria | 1942 |
| 27 | Ga0466714_019126 | 3300042603 | Bacteria | 2907 |
| 28 | Ga0466714_065872 | 3300042603 | Bacteria | 3705 |
| 29 | Ga0466719_313180 | 3300042606 | Bacteria | 4517 |
| 30 | Ga0466719_368486 | 3300042606 | Bacteria | 10168 |
| 31 | Ga0466719_383099 | 3300042606 | Unclassified | 4044 |
| 32 | Ga0466704_337498 | 3300042643 | Bacteria | 2644 |
| 33 | Ga0466708_055936 | 3300042652 | Bacteria | 1646 |
| 34 | Ga0466708_401244 | 3300042652 | Bacteria | 1471 |
| 35 | Ga0466727_202362 | 3300042655 | Bacteria | 6173 |
| 36 | Ga0466715_234918 | 3300042616 | Bacteria | 3883 |
| 37 | Ga0466723_219912 | 3300042618 | Bacteria | 9179 |
| 38 | Ga0466705_153543 | 3300042612 | Bacteria | 5157 |
| 39 | Ga0466705_255438 | 3300042612 | Bacteria | 4392 |
| 40 | Ga0466691_060293 | 3300042593 | Bacteria | 9009 |
| 41 | Ga0466696_192596 | 3300042596 | Bacteria | 16952 |
| 42 | Ga0123356_10309234 | 3300010049 | Unclassified | 1689 |
| 43 | Ga0123353_10499657 | 3300010167 | Bacteria | 1773 |
| 44 | Ga0466719_135473 | 3300042606 | Bacteria | 9615 |
| 45 | Ga0466702_133811 | 3300042635 | Bacteria | 6392 |
| 46 | Ga0466703_034272 | 3300042636 | Bacteria | 7465 |
| 47 | Ga0466703_221593 | 3300042636 | Unclassified | 1587 |
| 48 | IMNBL1DRAFT_c0003984 | 3300000062 | Bacteria | 9105 |
| 49 | Ga0466715_104482 | 3300042616 | Bacteria | 7518 |
| 50 | Ga0466715_170187 | 3300042616 | Bacteria | 8729 |
| 51 | Ga0466715_323023 | 3300042616 | Bacteria | 9416 |
| 52 | Ga0466723_076584 | 3300042618 | Bacteria | 5769 |
| 53 | Ga0466694_187773 | 3300042594 | Bacteria | 5681 |
| 54 | Ga0466696_134622 | 3300042596 | Bacteria | 4672 |
| 55 | Ga0466699_252736 | 3300042597 | Bacteria | 15581 |
| 56 | Ga0123353_10120923 | 3300010167 | Bacteria | 4211 |
| 57 | Ga0123353_10187244 | 3300010167 | Bacteria | 3271 |
| 58 | Ga0123353_10237461 | 3300010167 | Bacteria | 2835 |
| 59 | Ga0123354_10026804 | 3300010882 | Bacteria | 9089 |
| 60 | Ga0466701_022730 | 3300042598 | Bacteria | 7592 |
| 61 | Ga0466707_398016 | 3300042601 | Bacteria | 1491 |
| 62 | Ga0466717_090716 | 3300042604 | Unclassified | 2052 |
| 63 | Ga0466719_366587 | 3300042606 | Bacteria | 4259 |
| 64 | Ga0466720_119443 | 3300042607 | Bacteria | 2531 |
| 65 | Ga0466722_235852 | 3300042609 | Bacteria | 1495 |
| 66 | Ga0466703_014335 | 3300042636 | Bacteria | 2851 |
| 67 | Ga0466703_065065 | 3300042636 | Bacteria | 10516 |
| 68 | Ga0466704_179329 | 3300042643 | Bacteria | 11425 |
| 69 | Ga0466709_311304 | 3300042648 | Bacteria | 2624 |
| 70 | Ga0466723_123299 | 3300042618 | Bacteria | 8736 |
| 71 | Ga0466723_269892 | 3300042618 | Bacteria | 3231 |
| 72 | Ga0466705_021360 | 3300042612 | Bacteria | 16190 |
| 73 | Ga0466705_101651 | 3300042612 | Bacteria | 3981 |
| 74 | Ga0466705_254407 | 3300042612 | Bacteria | 5328 |
| 75 | Ga0466705_319537 | 3300042612 | Unclassified | 5108 |
| 76 | Ga0466733_063604 | 3300042659 | Bacteria | 3965 |
| 77 | Ga0466690_002574 | 3300042590 | Bacteria | 5557 |
| 78 | Ga0466690_140044 | 3300042590 | Unclassified | 3141 |
| 79 | Ga0466691_116456 | 3300042593 | Unclassified | 8854 |
| 80 | Ga0466696_305521 | 3300042596 | Bacteria | 23613 |
| 81 | Ga0466696_386403 | 3300042596 | Bacteria | 2924 |
| 82 | Ga0123354_10098747 | 3300010882 | Bacteria | 3968 |
| 83 | Ga0466714_062285 | 3300042603 | Bacteria | 1688 |
| 84 | Ga0466716_214603 | 3300042605 | Bacteria | 4812 |
| 85 | Ga0466716_473367 | 3300042605 | Bacteria | 2692 |
| 86 | Ga0466719_176491 | 3300042606 | Bacteria | 9446 |
| 87 | Ga0466698_097746 | 3300042610 | Bacteria | 1355 |
| 88 | Ga0466729_281867 | 3300042621 | Bacteria | 12739 |
| 89 | Ga0466731_158300 | 3300042622 | Bacteria | 1866 |
| 90 | Ga0466702_286324 | 3300042635 | Bacteria | 84451 |
| 91 | Ga0466703_050236 | 3300042636 | Bacteria | 42623 |
| 92 | Ga0466703_164263 | 3300042636 | Bacteria | 14821 |
| 93 | Ga0466704_004758 | 3300042643 | Bacteria | 42132 |
| 94 | Ga0466704_085677 | 3300042643 | Bacteria | 19634 |
| 95 | Ga0466704_313988 | 3300042643 | Bacteria | 5642 |
| 96 | Ga0466724_09426 | 3300042649 | Bacteria | 2178 |
| 97 | Ga0466727_272747 | 3300042655 | Unclassified | 1345 |
| 98 | Ga0466711_280464 | 3300042615 | Bacteria | 10150 |
| 99 | Ga0466723_207707 | 3300042618 | Bacteria | 18495 |
| 100 | Ga0466690_261580 | 3300042590 | Bacteria | 4126 |
| 101 | Ga0466691_022374 | 3300042593 | Bacteria | 3148 |
| 102 | Ga0466691_069225 | 3300042593 | Bacteria | 14352 |
| 103 | Ga0466691_130076 | 3300042593 | Bacteria | 2619 |
| 104 | Ga0466699_419901 | 3300042597 | Bacteria | 4236 |
| 105 | Ga0123357_10075873 | 3300009784 | Bacteria | 4442 |
| 106 | Ga0123353_10001331 | 3300010167 | Bacteria | 30253 |
| 107 | Ga0123353_10094891 | 3300010167 | Unclassified | 4806 |
| 108 | Ga0123353_10268804 | 3300010167 | Bacteria | 2628 |
| 109 | Ga0466706_002116 | 3300042599 | Bacteria | 9074 |
| 110 | Ga0466716_459199 | 3300042605 | Bacteria | 3271 |
| 111 | Ga0466734_136230 | 3300042623 | Bacteria | 1695 |
| 112 | Ga0466703_088825 | 3300042636 | Bacteria | 16247 |
| 113 | Ga0466708_331544 | 3300042652 | Bacteria | 24178 |
| 114 | 2227189125 | 2225789004 | Bacteria | 7947 |
| 115 | Ga0466723_049714 | 3300042618 | Bacteria | 2347 |
| 116 | Ga0466723_060774 | 3300042618 | Bacteria | 10759 |
| 117 | Ga0466723_093031 | 3300042618 | Bacteria | 42033 |
| 118 | Ga0466723_093738 | 3300042618 | Bacteria | 9019 |
| 119 | Ga0466728_418267 | 3300042620 | Bacteria | 16962 |
| 120 | Ga0466733_025190 | 3300042659 | Bacteria | 1287 |
| 121 | Ga0466696_097400 | 3300042596 | Bacteria | 2361 |
| 122 | Ga0123353_10247286 | 3300010167 | Bacteria | 2766 |
| 123 | Ga0123353_10263459 | 3300010167 | Bacteria | 2660 |
| 124 | Ga0123353_10287598 | 3300010167 | Bacteria | 2519 |
| 125 | Ga0466706_100655 | 3300042599 | Bacteria | 11090 |
| 126 | Ga0466707_233591 | 3300042601 | Bacteria | 2574 |
| 127 | Ga0466707_338674 | 3300042601 | Bacteria | 134309 |
| 128 | Ga0466713_155823 | 3300042602 | Bacteria | 1953 |
| 129 | Ga0466714_001544 | 3300042603 | Bacteria | 3748 |
| 130 | Ga0466714_007697 | 3300042603 | Bacteria | 17649 |
| 131 | Ga0466714_056525 | 3300042603 | Bacteria | 4303 |
| 132 | Ga0466714_159474 | 3300042603 | Bacteria | 1560 |
| 133 | Ga0466703_071916 | 3300042636 | Bacteria | 3050 |
| 134 | Ga0466704_153428 | 3300042643 | Bacteria | 14782 |
| 135 | Ga0466709_088818 | 3300042648 | Bacteria | 1604 |
| 136 | Ga0466708_152036 | 3300042652 | Bacteria | 2806 |
| 137 | Ga0466727_326544 | 3300042655 | Bacteria | 1442 |
| 138 | IMNBL1DRAFT_c0001957 | 3300000062 | Bacteria | 14840 |
| 139 | Ga0466711_021553 | 3300042615 | Bacteria | 2352 |
| 140 | Ga0466711_429964 | 3300042615 | Bacteria | 5353 |
| 141 | Ga0466715_006607 | 3300042616 | Unclassified | 3814 |
| 142 | Ga0466715_151771 | 3300042616 | Bacteria | 38958 |
| 143 | Ga0466726_242858 | 3300042619 | Bacteria | 1768 |
| 144 | Ga0466728_437639 | 3300042620 | Bacteria | 10716 |
| 145 | Ga0415639_017736 | 3300038395 | Bacteria | 32652 |
| 146 | Ga0466690_082937 | 3300042590 | Bacteria | 16911 |
| 147 | Ga0466690_096237 | 3300042590 | Bacteria | 6785 |
| 148 | Ga0466690_171043 | 3300042590 | Unclassified | 1995 |
| 149 | Ga0466696_012542 | 3300042596 | Bacteria | 4770 |
| 150 | Ga0466696_488323 | 3300042596 | Bacteria | 2226 |
| 151 | Ga0123357_10153891 | 3300009784 | Unclassified | 2780 |
| 152 | Ga0123357_10360939 | 3300009784 | Unclassified | 1376 |
| 153 | Ga0123353_10179812 | 3300010167 | Bacteria | 3350 |
| 154 | Ga0466714_057619 | 3300042603 | Bacteria | 1849 |
| 155 | Ga0466716_106037 | 3300042605 | Bacteria | 5150 |
| 156 | Ga0466703_015114 | 3300042636 | Bacteria | 3656 |
| 157 | Ga0466703_152440 | 3300042636 | Bacteria | 7064 |
| 158 | Ga0466704_062567 | 3300042643 | Bacteria | 3934 |
| 159 | Ga0466704_063927 | 3300042643 | Bacteria | 16564 |
| 160 | Ga0466709_046391 | 3300042648 | Bacteria | 5188 |
| 161 | IMNBL1DRAFT_c0015947 | 3300000062 | Bacteria | 3236 |
| 162 | Ga0466723_211719 | 3300042618 | Bacteria | 9750 |
| 163 | Ga0466726_228908 | 3300042619 | Bacteria | 6931 |
| 164 | Ga0466728_152008 | 3300042620 | Bacteria | 9182 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.