Protein Family IF08116
Metagenome
Isolate
248
Members
62
Samples
234
Scaffolds
292.79
Avg Length
Representative Sequence
- ID
- 3300042618|Ga0466723_210681|Ga0466723_210681_3853_4875
- Length
- 340 aa
- Sequence
- MTEAGNLAGLREAAPSQAELDRRDTEKSQKIDVSVFSVSGSISMDLQTFLQQFVNALSLGSLYALIAIGYTMVYGILRLINFAHGDIFMIGGYLAFYGVGIFAMPWWLSACLAIALTTVFGVGLERAAYRPLRDSPRISIMISAIGASFLIENLAIVLFDARPKAFPVPGLFAANHVVGGIHVASVSLIIPLVTAVLLAILLWIVHRTRTGMAMRAVSTDIEAARLMAVDVDRIVSVTFAIGSALAAIGGILFALKYPRLEPLMGIMPGMKCFIAAVVGGIGSIGGAVLXXLLLGLIELMTIAFLPELTGYKDAFAFILLIAVLLFKPTGLLGRNQGEKV
Sample Types
Isolate
5.7%
Metagenome
94.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.9%
Kalotermitidae
22.6%
Unclassified
21.0%
Rhinotermitidae
4.8%
Termopsidae
4.8%
Blattidae
3.2%
Hodotermitidae
1.6%
Taxonomy
Archaea
0
Bacteria
223
Eukaryota
0
Viruses
0
Unclassified
25
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 2 | 2820344559 | Unclassified Firmicutes Nt197P3bin63 | Isolate | Unclassified |
| 3 | 2820573558 | Unclassified Firmicutes Emb289P3bin140 | Isolate | Unclassified |
| 4 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 5 | 2820901319 | Unclassified Actinobacteria Emb289P4bin58 | Isolate | Unclassified |
| 6 | 2940241992 | Fusobacterium sp. PH5-29 | Isolate | Blattidae |
| 7 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 8 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 9 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 10 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 11 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 12 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 13 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 14 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 15 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 16 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 17 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 18 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 19 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 20 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 21 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 22 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 23 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 24 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 25 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 26 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 27 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 28 | 2820367663 | Unclassified Firmicutes Nt197P3bin105 | Isolate | Unclassified |
| 29 | 2820389254 | Unclassified Firmicutes Nc150P4bin19 | Isolate | Unclassified |
| 30 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 31 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 32 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 33 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 34 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 35 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 36 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 37 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 38 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 39 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 40 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 41 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 42 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 43 | 2820332331 | Unclassified Firmicutes Nt197P3bin75 | Isolate | Unclassified |
| 44 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 45 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 46 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 47 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 48 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 49 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 50 | 2940349480 | Fusobacterium sp. PH5-44 | Isolate | Blattidae |
| 51 | 2820353569 | Unclassified Firmicutes Nt197P3bin28 | Isolate | Unclassified |
| 52 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 53 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 54 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 55 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 56 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 57 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 58 | 2593339125 | Clostridium sp. 5 | Isolate | Termitidae |
| 59 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 60 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 61 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 62 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_455008 | 3300042612 | Bacteria | 8073 |
| 2 | Ga0466711_457189 | 3300042615 | Unclassified | 3122 |
| 3 | Ga0466715_289389 | 3300042616 | Bacteria | 2342 |
| 4 | Ga0466723_119865 | 3300042618 | Bacteria | 4969 |
| 5 | Ga0466723_210681 | 3300042618 | Bacteria | 8686 |
| 6 | Ga0466723_286733 | 3300042618 | Bacteria | 5385 |
| 7 | Ga0466726_489899 | 3300042619 | Bacteria | 3341 |
| 8 | Ga0466728_023166 | 3300042620 | Bacteria | 15136 |
| 9 | Ga0466707_392749 | 3300042601 | Unclassified | 1559 |
| 10 | Ga0466716_009123 | 3300042605 | Bacteria | 5844 |
| 11 | Ga0466716_234663 | 3300042605 | Bacteria | 14955 |
| 12 | Ga0466720_108612 | 3300042607 | Bacteria | 122313 |
| 13 | Ga0466722_017904 | 3300042609 | Bacteria | 9151 |
| 14 | Ga0466722_203712 | 3300042609 | Bacteria | 16455 |
| 15 | Ga0466699_328497 | 3300042597 | Bacteria | 3903 |
| 16 | Ga0466730_088263 | 3300042625 | Bacteria | 3578 |
| 17 | Ga0466703_003421 | 3300042636 | Bacteria | 2968 |
| 18 | Ga0466703_028252 | 3300042636 | Bacteria | 7507 |
| 19 | Ga0466704_271558 | 3300042643 | Unclassified | 2891 |
| 20 | Ga0466704_325436 | 3300042643 | Bacteria | 20045 |
| 21 | Ga0466704_367446 | 3300042643 | Unclassified | 2797 |
| 22 | Ga0466708_379270 | 3300042652 | Bacteria | 6383 |
| 23 | Ga0123357_10324481 | 3300009784 | Bacteria | 1515 |
| 24 | Ga0123356_10006880 | 3300010049 | Bacteria | 11432 |
| 25 | Ga0123353_10243900 | 3300010167 | Bacteria | 2789 |
| 26 | Ga0123353_10474457 | 3300010167 | Bacteria | 1833 |
| 27 | Ga0466705_031344 | 3300042612 | Bacteria | 7704 |
| 28 | Ga0466733_005154 | 3300042659 | Bacteria | 7162 |
| 29 | Ga0466723_059840 | 3300042618 | Bacteria | 7293 |
| 30 | Ga0466723_150825 | 3300042618 | Bacteria | 28092 |
| 31 | Ga0466723_273592 | 3300042618 | Bacteria | 1565 |
| 32 | Ga0466728_100942 | 3300042620 | Bacteria | 2925 |
| 33 | Ga0466706_157065 | 3300042599 | Bacteria | 1199 |
| 34 | Ga0466707_314581 | 3300042601 | Bacteria | 2078 |
| 35 | Ga0466713_032418 | 3300042602 | Unclassified | 9062 |
| 36 | Ga0466719_016381 | 3300042606 | Bacteria | 11568 |
| 37 | Ga0466722_202935 | 3300042609 | Bacteria | 17346 |
| 38 | Ga0466692_128479 | 3300042591 | Bacteria | 4325 |
| 39 | Ga0466692_178879 | 3300042591 | Bacteria | 10474 |
| 40 | Ga0466691_126990 | 3300042593 | Bacteria | 2193 |
| 41 | Ga0466694_056533 | 3300042594 | Bacteria | 2253 |
| 42 | Ga0466696_066835 | 3300042596 | Bacteria | 17124 |
| 43 | Ga0466696_082900 | 3300042596 | Bacteria | 49002 |
| 44 | Ga0466735_068594 | 3300042624 | Bacteria | 1333 |
| 45 | Ga0466708_008245 | 3300042652 | Bacteria | 3353 |
| 46 | Ga0466708_013199 | 3300042652 | Bacteria | 10768 |
| 47 | Ga0466727_192180 | 3300042655 | Bacteria | 1168 |
| 48 | Ga0068305_10004400 | 3300005083 | Bacteria | 19968 |
| 49 | Ga0123355_10000558 | 3300009826 | Bacteria | 49958 |
| 50 | Ga0123353_10646240 | 3300010167 | Bacteria | 1499 |
| 51 | Ga0466712_023033 | 3300042614 | Bacteria | 1296 |
| 52 | Ga0466715_200322 | 3300042616 | Bacteria | 4718 |
| 53 | Ga0466718_004820 | 3300042617 | Bacteria | 3634 |
| 54 | Ga0466723_147912 | 3300042618 | Bacteria | 18502 |
| 55 | Ga0466726_038525 | 3300042619 | Bacteria | 7563 |
| 56 | Ga0466729_062625 | 3300042621 | Bacteria | 6109 |
| 57 | Ga0466706_192217 | 3300042599 | Bacteria | 5127 |
| 58 | Ga0466707_230858 | 3300042601 | Bacteria | 5710 |
| 59 | Ga0466707_250808 | 3300042601 | Bacteria | 1289 |
| 60 | Ga0466707_382539 | 3300042601 | Unclassified | 2875 |
| 61 | Ga0466719_068300 | 3300042606 | Bacteria | 3572 |
| 62 | Ga0466722_007796 | 3300042609 | Bacteria | 3759 |
| 63 | Ga0466722_168284 | 3300042609 | Bacteria | 10950 |
| 64 | Ga0466657_050621 | 3300042582 | Bacteria | 1070 |
| 65 | Ga0466692_118585 | 3300042591 | Bacteria | 1838 |
| 66 | Ga0466694_176995 | 3300042594 | Unclassified | 2006 |
| 67 | Ga0466696_150939 | 3300042596 | Bacteria | 1964 |
| 68 | Ga0466735_060663 | 3300042624 | Bacteria | 4314 |
| 69 | Ga0466704_115725 | 3300042643 | Bacteria | 5897 |
| 70 | Ga0466708_069259 | 3300042652 | Bacteria | 49691 |
| 71 | Ga0068305_10329338 | 3300005083 | Bacteria | 27771 |
| 72 | Ga0123357_10139028 | 3300009784 | Bacteria | 2992 |
| 73 | Ga0123355_10246421 | 3300009826 | Unclassified | 2523 |
| 74 | Ga0123356_10004381 | 3300010049 | Bacteria | 14587 |
| 75 | Ga0123356_10655453 | 3300010049 | Bacteria | 1217 |
| 76 | Ga0123353_10049162 | 3300010167 | Bacteria | 6717 |
| 77 | Ga0123353_10175986 | 3300010167 | Bacteria | 3392 |
| 78 | Ga0123353_10587083 | 3300010167 | Bacteria | 1597 |
| 79 | Ga0466732_102116 | 3300042656 | Bacteria | 3488 |
| 80 | Ga0466712_227066 | 3300042614 | Bacteria | 3775 |
| 81 | Ga0466711_071324 | 3300042615 | Bacteria | 1347 |
| 82 | Ga0466711_210375 | 3300042615 | Bacteria | 51464 |
| 83 | Ga0466715_025004 | 3300042616 | Bacteria | 13217 |
| 84 | Ga0466715_058114 | 3300042616 | Bacteria | 12665 |
| 85 | Ga0466715_060943 | 3300042616 | Bacteria | 9404 |
| 86 | Ga0466715_567417 | 3300042616 | Bacteria | 3687 |
| 87 | Ga0466723_315815 | 3300042618 | Bacteria | 18792 |
| 88 | Ga0466726_036876 | 3300042619 | Bacteria | 3752 |
| 89 | Ga0466726_135832 | 3300042619 | Bacteria | 5080 |
| 90 | Ga0466729_125050 | 3300042621 | Bacteria | 1481 |
| 91 | Ga0466707_078647 | 3300042601 | Bacteria | 2987 |
| 92 | Ga0466713_023553 | 3300042602 | Bacteria | 168712 |
| 93 | Ga0466717_046182 | 3300042604 | Bacteria | 2014 |
| 94 | Ga0466716_213178 | 3300042605 | Bacteria | 5864 |
| 95 | Ga0466719_178165 | 3300042606 | Bacteria | 5108 |
| 96 | Ga0466698_328623 | 3300042610 | Bacteria | 1890 |
| 97 | Ga0466691_070103 | 3300042593 | Bacteria | 31827 |
| 98 | Ga0466691_091661 | 3300042593 | Bacteria | 8865 |
| 99 | Ga0466696_258149 | 3300042596 | Bacteria | 13063 |
| 100 | Ga0466734_014373 | 3300042623 | Bacteria | 1832 |
| 101 | Ga0466735_135114 | 3300042624 | Bacteria | 12343 |
| 102 | Ga0466703_073945 | 3300042636 | Bacteria | 2882 |
| 103 | Ga0466704_524472 | 3300042643 | Unclassified | 1426 |
| 104 | Ga0466727_348499 | 3300042655 | Bacteria | 48588 |
| 105 | JGI24695J34938_10007973 | 3300002450 | Bacteria | 6112 |
| 106 | JGI24695J34938_10124594 | 3300002450 | Bacteria | 1049 |
| 107 | Ga0072940_1157660 | 3300005200 | Bacteria | 1936 |
| 108 | Ga0123357_10144138 | 3300009784 | Bacteria | 2916 |
| 109 | Ga0466705_035491 | 3300042612 | Bacteria | 7574 |
| 110 | Ga0466705_112086 | 3300042612 | Bacteria | 12461 |
| 111 | Ga0466715_074298 | 3300042616 | Bacteria | 6698 |
| 112 | Ga0466726_415802 | 3300042619 | Bacteria | 5822 |
| 113 | Ga0466726_433645 | 3300042619 | Bacteria | 7660 |
| 114 | Ga0466728_169827 | 3300042620 | Bacteria | 2318 |
| 115 | Ga0466728_169878 | 3300042620 | Unclassified | 2107 |
| 116 | Ga0466717_226866 | 3300042604 | Bacteria | 1733 |
| 117 | Ga0466717_280081 | 3300042604 | Bacteria | 1242 |
| 118 | Ga0466719_178271 | 3300042606 | Bacteria | 3875 |
| 119 | Ga0466719_231181 | 3300042606 | Bacteria | 3826 |
| 120 | Ga0466719_517917 | 3300042606 | Bacteria | 23969 |
| 121 | Ga0466722_007465 | 3300042609 | Bacteria | 26514 |
| 122 | Ga0466690_010693 | 3300042590 | Bacteria | 8227 |
| 123 | Ga0466690_190397 | 3300042590 | Bacteria | 8163 |
| 124 | Ga0466692_021582 | 3300042591 | Unclassified | 2028 |
| 125 | Ga0466693_167887 | 3300042592 | Bacteria | 10383 |
| 126 | Ga0466696_358199 | 3300042596 | Bacteria | 4409 |
| 127 | Ga0466729_208015 | 3300042621 | Bacteria | 4221 |
| 128 | Ga0466704_156970 | 3300042643 | Bacteria | 1516 |
| 129 | Ga0466704_303475 | 3300042643 | Unclassified | 2845 |
| 130 | Ga0466704_333902 | 3300042643 | Bacteria | 5799 |
| 131 | Ga0466704_522007 | 3300042643 | Bacteria | 15059 |
| 132 | Ga0466704_547421 | 3300042643 | Unclassified | 5047 |
| 133 | AustNasuHG_c1003625 | 3300000089 | Bacteria | 5570 |
| 134 | Ga0123356_10091287 | 3300010049 | Bacteria | 2903 |
| 135 | Ga0123356_10131760 | 3300010049 | Bacteria | 2450 |
| 136 | Ga0123356_10498944 | 3300010049 | Bacteria | 1373 |
| 137 | Ga0123353_10037167 | 3300010167 | Bacteria | 7636 |
| 138 | Ga0123353_10189130 | 3300010167 | Bacteria | 3252 |
| 139 | Ga0466705_111836 | 3300042612 | Bacteria | 12299 |
| 140 | Ga0466705_336311 | 3300042612 | Bacteria | 6620 |
| 141 | Ga0466732_104230 | 3300042656 | Bacteria | 1601 |
| 142 | Ga0466711_246502 | 3300042615 | Bacteria | 18201 |
| 143 | Ga0466715_076216 | 3300042616 | Bacteria | 5367 |
| 144 | Ga0466715_397221 | 3300042616 | Bacteria | 3225 |
| 145 | Ga0466726_033442 | 3300042619 | Bacteria | 8708 |
| 146 | Ga0466728_179607 | 3300042620 | Bacteria | 19336 |
| 147 | Ga0466713_008943 | 3300042602 | Bacteria | 15222 |
| 148 | Ga0466713_127527 | 3300042602 | Unclassified | 78528 |
| 149 | Ga0466716_017595 | 3300042605 | Bacteria | 5705 |
| 150 | Ga0466716_175919 | 3300042605 | Bacteria | 3147 |
| 151 | Ga0466719_132315 | 3300042606 | Bacteria | 14338 |
| 152 | Ga0466719_233492 | 3300042606 | Bacteria | 2315 |
| 153 | Ga0466719_269906 | 3300042606 | Bacteria | 4147 |
| 154 | Ga0466722_069109 | 3300042609 | Bacteria | 31526 |
| 155 | Ga0466722_073106 | 3300042609 | Bacteria | 11615 |
| 156 | Ga0466722_076744 | 3300042609 | Bacteria | 1929 |
| 157 | Ga0466692_159532 | 3300042591 | Bacteria | 14500 |
| 158 | Ga0466691_185837 | 3300042593 | Bacteria | 10481 |
| 159 | Ga0466696_030030 | 3300042596 | Bacteria | 1317 |
| 160 | Ga0466696_155739 | 3300042596 | Bacteria | 5265 |
| 161 | Ga0466699_354350 | 3300042597 | Bacteria | 3188 |
| 162 | Ga0466701_002010 | 3300042598 | Unclassified | 7969 |
| 163 | Ga0466703_300653 | 3300042636 | Bacteria | 10877 |
| 164 | Ga0466704_466856 | 3300042643 | Bacteria | 8356 |
| 165 | Ga0466708_083996 | 3300042652 | Bacteria | 14281 |
| 166 | Ga0466708_099906 | 3300042652 | Bacteria | 39915 |
| 167 | Ga0466708_142045 | 3300042652 | Bacteria | 21166 |
| 168 | Ga0466727_080249 | 3300042655 | Bacteria | 3503 |
| 169 | JGI24695J34938_10015198 | 3300002450 | Bacteria | 3956 |
| 170 | Ga0466705_105957 | 3300042612 | Unclassified | 5091 |
| 171 | Ga0466705_124762 | 3300042612 | Unclassified | 1024 |
| 172 | Ga0466705_402776 | 3300042612 | Unclassified | 3071 |
| 173 | Ga0466715_242579 | 3300042616 | Bacteria | 5390 |
| 174 | Ga0466715_519280 | 3300042616 | Bacteria | 12079 |
| 175 | Ga0466718_116731 | 3300042617 | Unclassified | 1732 |
| 176 | Ga0466723_272747 | 3300042618 | Bacteria | 5531 |
| 177 | Ga0466726_028312 | 3300042619 | Bacteria | 5730 |
| 178 | Ga0466726_239531 | 3300042619 | Bacteria | 2297 |
| 179 | Ga0466713_017040 | 3300042602 | Bacteria | 9376 |
| 180 | Ga0466716_144401 | 3300042605 | Unclassified | 1579 |
| 181 | Ga0466719_261837 | 3300042606 | Bacteria | 14594 |
| 182 | Ga0466719_271470 | 3300042606 | Bacteria | 8292 |
| 183 | Ga0466719_282348 | 3300042606 | Unclassified | 19679 |
| 184 | Ga0466720_042248 | 3300042607 | Bacteria | 2025 |
| 185 | Ga0466690_267699 | 3300042590 | Unclassified | 2820 |
| 186 | Ga0466692_076165 | 3300042591 | Bacteria | 58218 |
| 187 | Ga0466694_156050 | 3300042594 | Bacteria | 2482 |
| 188 | Ga0466696_117133 | 3300042596 | Bacteria | 5653 |
| 189 | Ga0466735_089790 | 3300042624 | Bacteria | 1785 |
| 190 | Ga0466703_088782 | 3300042636 | Bacteria | 17464 |
| 191 | Ga0466703_092017 | 3300042636 | Bacteria | 8278 |
| 192 | Ga0466704_128579 | 3300042643 | Bacteria | 1511 |
| 193 | Ga0466704_283505 | 3300042643 | Bacteria | 3411 |
| 194 | Ga0466709_091610 | 3300042648 | Bacteria | 4989 |
| 195 | Ga0466709_394333 | 3300042648 | Bacteria | 6049 |
| 196 | Ga0466708_060878 | 3300042652 | Bacteria | 2629 |
| 197 | Ga0068305_10012411 | 3300005083 | Bacteria | 9352 |
| 198 | Ga0068305_10048922 | 3300005083 | Bacteria | 13977 |
| 199 | Ga0123357_10000439 | 3300009784 | Bacteria | 39918 |
| 200 | Ga0123356_10121107 | 3300010049 | Bacteria | 2545 |
| 201 | Ga0123356_10219655 | 3300010049 | Bacteria | 1956 |
| 202 | Ga0123353_10205065 | 3300010167 | Bacteria | 3098 |
| 203 | Ga0123353_10922274 | 3300010167 | Bacteria | 1186 |
| 204 | Ga0123354_10266770 | 3300010882 | Bacteria | 1695 |
| 205 | Ga0466705_105838 | 3300042612 | Bacteria | 8008 |
| 206 | Ga0466705_354195 | 3300042612 | Bacteria | 15438 |
| 207 | Ga0466732_093551 | 3300042656 | Unclassified | 1314 |
| 208 | Ga0466712_188805 | 3300042614 | Bacteria | 13038 |
| 209 | Ga0466711_353856 | 3300042615 | Bacteria | 8505 |
| 210 | Ga0466715_187717 | 3300042616 | Bacteria | 58117 |
| 211 | Ga0466723_373824 | 3300042618 | Bacteria | 4530 |
| 212 | Ga0466726_030349 | 3300042619 | Bacteria | 6894 |
| 213 | Ga0466714_115211 | 3300042603 | Bacteria | 3334 |
| 214 | Ga0466717_131205 | 3300042604 | Bacteria | 2312 |
| 215 | Ga0466716_038086 | 3300042605 | Bacteria | 8613 |
| 216 | Ga0466719_166393 | 3300042606 | Bacteria | 37091 |
| 217 | Ga0466721_391278 | 3300042608 | Bacteria | 10971 |
| 218 | Ga0466690_094456 | 3300042590 | Bacteria | 15806 |
| 219 | Ga0466690_131379 | 3300042590 | Bacteria | 17000 |
| 220 | Ga0466690_187291 | 3300042590 | Bacteria | 4916 |
| 221 | Ga0466690_215254 | 3300042590 | Unclassified | 2856 |
| 222 | Ga0466691_004320 | 3300042593 | Bacteria | 16520 |
| 223 | Ga0466696_369175 | 3300042596 | Bacteria | 2501 |
| 224 | Ga0466704_080954 | 3300042643 | Bacteria | 11536 |
| 225 | Ga0466704_130210 | 3300042643 | Bacteria | 6010 |
| 226 | Ga0466704_304480 | 3300042643 | Bacteria | 25615 |
| 227 | Ga0466704_472493 | 3300042643 | Bacteria | 20359 |
| 228 | Ga0466708_327203 | 3300042652 | Bacteria | 31501 |
| 229 | Ga0466708_401033 | 3300042652 | Bacteria | 3677 |
| 230 | Ga0466727_016961 | 3300042655 | Bacteria | 2370 |
| 231 | Ga0068305_10016615 | 3300005083 | Bacteria | 9120 |
| 232 | Ga0123356_10080548 | 3300010049 | Unclassified | 3079 |
| 233 | Ga0123353_10157244 | 3300010167 | Bacteria | 3622 |
| 234 | Ga0123354_10157069 | 3300010882 | Bacteria | 2722 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02653 | BPD_transp_2 | Branched-chain amino acid transport system / permease component | 54 | 324 | 0.92 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.