Protein Family IF08077
Metagenome
Isolate
201
Members
38
Samples
195
Scaffolds
330.19
Avg Length
Representative Sequence
- ID
- 3300042618|Ga0466723_130141|Ga0466723_130141_57042_58184
- Length
- 380 aa
- Sequence
- MLWMLLLTETNRNENNGYGKSGKIKGRRSGPQLPAAGLPDFHTKKEKSMKKVCMALACALGLLACSNRDGGQQGAVEDINIGIAKYLQHEALDACENGIQDALILRGYNPIFDLQNANGDPNTAAQIANKFKSDRVRVAVGIATPMAEALANAMTDTPVIFSAVTDPVTARLVTSLDRGEGNVTGLSDAIPTVDHIGMFQKIAGIKTLGYIYTSSEDNSLSALTLVEEGCKKYGITLVTQAITGSAELQAAAQAVVNRVEGIYLTTDNTVFSALPALIQVFQRAKKPIFSGDVTGAMNGGCLIASGFNYYKAGLATGNIVADVLEGKNPADIPVKFLTDPSESDLLFDLDAAANCGITIPEEYLSQANYIFQEGALIQMQ
Sample Types
Isolate
3.0%
Metagenome
97.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
36.8%
Termitidae
21.1%
Unclassified
18.4%
Rhinotermitidae
10.5%
Termopsidae
7.9%
Blaberidae
2.6%
Hodotermitidae
2.6%
Taxonomy
Archaea
0
Bacteria
194
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 2 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 3 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 4 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 5 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 6 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 7 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 8 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 12 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 13 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 14 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 15 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 16 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 17 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 18 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 19 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 20 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 21 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 22 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 23 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 24 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 25 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 26 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 27 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 28 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 29 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 30 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 31 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 32 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 33 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 34 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 35 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 36 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 37 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 38 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466703_148217 | 3300042636 | Bacteria | 7222 |
| 2 | Ga0466704_162661 | 3300042643 | Bacteria | 42824 |
| 3 | Ga0466704_207174 | 3300042643 | Bacteria | 4955 |
| 4 | Ga0466709_254184 | 3300042648 | Bacteria | 4758 |
| 5 | Ga0466708_046650 | 3300042652 | Bacteria | 2016 |
| 6 | Ga0466727_152456 | 3300042655 | Bacteria | 11746 |
| 7 | Ga0466727_230491 | 3300042655 | Bacteria | 44965 |
| 8 | Ga0466706_041970 | 3300042599 | Bacteria | 1320 |
| 9 | Ga0466714_047842 | 3300042603 | Bacteria | 9531 |
| 10 | Ga0466716_028303 | 3300042605 | Bacteria | 11334 |
| 11 | Ga0456237_0003821 | 3300041968 | Bacteria | 2429 |
| 12 | Ga0466690_045833 | 3300042590 | Bacteria | 2650 |
| 13 | Ga0466690_190396 | 3300042590 | Bacteria | 13234 |
| 14 | Ga0466691_007362 | 3300042593 | Bacteria | 12880 |
| 15 | Ga0466691_138396 | 3300042593 | Bacteria | 10118 |
| 16 | Ga0466699_061223 | 3300042597 | Bacteria | 9352 |
| 17 | Ga0123356_10091004 | 3300010049 | Bacteria | 2906 |
| 18 | Ga0123353_10046886 | 3300010167 | Bacteria | 6870 |
| 19 | Ga0123353_10377834 | 3300010167 | Bacteria | 2121 |
| 20 | Ga0123354_10050361 | 3300010882 | Bacteria | 6305 |
| 21 | Ga0466705_425569 | 3300042612 | Bacteria | 3110 |
| 22 | Ga0466711_149904 | 3300042615 | Bacteria | 12480 |
| 23 | Ga0466715_360565 | 3300042616 | Bacteria | 19870 |
| 24 | Ga0466715_453964 | 3300042616 | Bacteria | 2955 |
| 25 | Ga0466723_124748 | 3300042618 | Bacteria | 48807 |
| 26 | Ga0466723_280438 | 3300042618 | Bacteria | 2890 |
| 27 | Ga0466726_251108 | 3300042619 | Bacteria | 2254 |
| 28 | Ga0466728_053750 | 3300042620 | Bacteria | 2713 |
| 29 | Ga0466728_336779 | 3300042620 | Bacteria | 4179 |
| 30 | Ga0466705_022600 | 3300042612 | Bacteria | 5801 |
| 31 | Ga0466733_029630 | 3300042659 | Bacteria | 2603 |
| 32 | Ga0466704_194595 | 3300042643 | Bacteria | 4264 |
| 33 | Ga0466709_237876 | 3300042648 | Bacteria | 1951 |
| 34 | Ga0466708_049658 | 3300042652 | Bacteria | 13372 |
| 35 | Ga0466707_142380 | 3300042601 | Unclassified | 1448 |
| 36 | Ga0466713_149231 | 3300042602 | Bacteria | 1119 |
| 37 | Ga0466719_327763 | 3300042606 | Bacteria | 4346 |
| 38 | Ga0466719_501541 | 3300042606 | Bacteria | 2316 |
| 39 | Ga0466722_230268 | 3300042609 | Bacteria | 3348 |
| 40 | Ga0466690_125591 | 3300042590 | Bacteria | 3277 |
| 41 | Ga0466690_156916 | 3300042590 | Bacteria | 25755 |
| 42 | Ga0466690_186834 | 3300042590 | Bacteria | 2092 |
| 43 | Ga0466690_299050 | 3300042590 | Bacteria | 2361 |
| 44 | Ga0466691_004603 | 3300042593 | Bacteria | 2266 |
| 45 | Ga0466696_062324 | 3300042596 | Bacteria | 12238 |
| 46 | Ga0466696_492809 | 3300042596 | Bacteria | 2084 |
| 47 | Ga0466699_211009 | 3300042597 | Bacteria | 48420 |
| 48 | Ga0466711_417321 | 3300042615 | Bacteria | 3090 |
| 49 | Ga0466715_129954 | 3300042616 | Bacteria | 1919 |
| 50 | Ga0466723_063054 | 3300042618 | Bacteria | 16177 |
| 51 | Ga0466723_224829 | 3300042618 | Bacteria | 1771 |
| 52 | Ga0466704_115508 | 3300042643 | Bacteria | 7021 |
| 53 | Ga0466704_260219 | 3300042643 | Bacteria | 8476 |
| 54 | Ga0466704_268117 | 3300042643 | Bacteria | 56383 |
| 55 | Ga0466709_313270 | 3300042648 | Bacteria | 4462 |
| 56 | Ga0466708_210676 | 3300042652 | Bacteria | 5566 |
| 57 | Ga0466713_094221 | 3300042602 | Bacteria | 1665 |
| 58 | Ga0466716_126633 | 3300042605 | Bacteria | 3683 |
| 59 | Ga0466716_305055 | 3300042605 | Bacteria | 2092 |
| 60 | Ga0466719_084144 | 3300042606 | Bacteria | 12012 |
| 61 | Ga0466719_487829 | 3300042606 | Bacteria | 5221 |
| 62 | Ga0466722_002890 | 3300042609 | Bacteria | 6147 |
| 63 | Ga0466691_130059 | 3300042593 | Bacteria | 42419 |
| 64 | Ga0466691_168975 | 3300042593 | Bacteria | 2122 |
| 65 | Ga0466711_086818 | 3300042615 | Bacteria | 3739 |
| 66 | Ga0466711_398488 | 3300042615 | Bacteria | 2966 |
| 67 | Ga0466715_110172 | 3300042616 | Bacteria | 5400 |
| 68 | Ga0466715_147503 | 3300042616 | Bacteria | 22013 |
| 69 | Ga0466715_284493 | 3300042616 | Bacteria | 1706 |
| 70 | Ga0466723_130141 | 3300042618 | Bacteria | 92926 |
| 71 | Ga0466723_203337 | 3300042618 | Bacteria | 6189 |
| 72 | Ga0466726_153858 | 3300042619 | Bacteria | 11453 |
| 73 | Ga0466728_077469 | 3300042620 | Bacteria | 3797 |
| 74 | JGI24695J34938_10000504 | 3300002450 | Bacteria | 37894 |
| 75 | Ga0466705_089208 | 3300042612 | Bacteria | 4799 |
| 76 | Ga0466705_126824 | 3300042612 | Bacteria | 17126 |
| 77 | Ga0466705_131877 | 3300042612 | Bacteria | 9517 |
| 78 | Ga0466733_068811 | 3300042659 | Unclassified | 2185 |
| 79 | Ga0466735_233831 | 3300042624 | Bacteria | 6677 |
| 80 | Ga0466704_111696 | 3300042643 | Bacteria | 3330 |
| 81 | Ga0466709_009123 | 3300042648 | Bacteria | 6130 |
| 82 | Ga0466708_045546 | 3300042652 | Bacteria | 1855 |
| 83 | Ga0466727_295604 | 3300042655 | Bacteria | 1774 |
| 84 | Ga0466707_185190 | 3300042601 | Bacteria | 6893 |
| 85 | Ga0466713_115973 | 3300042602 | Bacteria | 2962 |
| 86 | Ga0466716_394170 | 3300042605 | Bacteria | 3854 |
| 87 | Ga0466716_406177 | 3300042605 | Bacteria | 2872 |
| 88 | Ga0466719_253548 | 3300042606 | Bacteria | 1326 |
| 89 | Ga0466719_293881 | 3300042606 | Bacteria | 1206 |
| 90 | Ga0466719_324638 | 3300042606 | Bacteria | 8947 |
| 91 | Ga0466719_387996 | 3300042606 | Bacteria | 1313 |
| 92 | Ga0466722_074415 | 3300042609 | Bacteria | 22858 |
| 93 | Ga0466696_199495 | 3300042596 | Bacteria | 4145 |
| 94 | Ga0466699_008266 | 3300042597 | Bacteria | 11561 |
| 95 | Ga0466711_139186 | 3300042615 | Bacteria | 22031 |
| 96 | Ga0466723_046020 | 3300042618 | Bacteria | 3550 |
| 97 | Ga0466723_108708 | 3300042618 | Bacteria | 3272 |
| 98 | Ga0466728_001903 | 3300042620 | Bacteria | 4848 |
| 99 | Ga0466728_213479 | 3300042620 | Bacteria | 4281 |
| 100 | Ga0466729_066328 | 3300042621 | Bacteria | 1586 |
| 101 | Ga0466705_208964 | 3300042612 | Bacteria | 5640 |
| 102 | Ga0466705_266269 | 3300042612 | Bacteria | 3216 |
| 103 | Ga0466705_361355 | 3300042612 | Bacteria | 2650 |
| 104 | Ga0466709_325630 | 3300042648 | Bacteria | 12039 |
| 105 | Ga0466709_412360 | 3300042648 | Bacteria | 3430 |
| 106 | Ga0466707_144840 | 3300042601 | Bacteria | 1383 |
| 107 | Ga0466713_019033 | 3300042602 | Bacteria | 2514 |
| 108 | Ga0466716_333137 | 3300042605 | Bacteria | 1201 |
| 109 | Ga0466719_505987 | 3300042606 | Unclassified | 3640 |
| 110 | Ga0466722_244828 | 3300042609 | Bacteria | 3355 |
| 111 | Ga0456237_0002384 | 3300041968 | Bacteria | 3036 |
| 112 | Ga0466690_003935 | 3300042590 | Bacteria | 1301 |
| 113 | Ga0466690_054423 | 3300042590 | Bacteria | 2248 |
| 114 | Ga0466692_072358 | 3300042591 | Bacteria | 4363 |
| 115 | Ga0466691_007169 | 3300042593 | Bacteria | 22555 |
| 116 | Ga0466691_013504 | 3300042593 | Bacteria | 4666 |
| 117 | Ga0466696_137372 | 3300042596 | Bacteria | 16678 |
| 118 | Ga0466699_028711 | 3300042597 | Bacteria | 25309 |
| 119 | Ga0123357_10061380 | 3300009784 | Bacteria | 5037 |
| 120 | Ga0466711_213064 | 3300042615 | Unclassified | 10022 |
| 121 | Ga0466711_342698 | 3300042615 | Bacteria | 2960 |
| 122 | Ga0466715_144464 | 3300042616 | Bacteria | 3500 |
| 123 | Ga0466723_145141 | 3300042618 | Bacteria | 9270 |
| 124 | Ga0466728_015616 | 3300042620 | Bacteria | 15674 |
| 125 | Ga0466705_044479 | 3300042612 | Bacteria | 2340 |
| 126 | Ga0466705_155272 | 3300042612 | Unclassified | 3472 |
| 127 | Ga0466733_024461 | 3300042659 | Bacteria | 2542 |
| 128 | Ga0466735_007259 | 3300042624 | Bacteria | 1941 |
| 129 | Ga0466703_090466 | 3300042636 | Bacteria | 2993 |
| 130 | Ga0466703_200348 | 3300042636 | Bacteria | 25667 |
| 131 | Ga0466703_346162 | 3300042636 | Bacteria | 3424 |
| 132 | Ga0466709_021132 | 3300042648 | Bacteria | 11477 |
| 133 | Ga0466709_418164 | 3300042648 | Bacteria | 8521 |
| 134 | Ga0466708_124302 | 3300042652 | Bacteria | 47506 |
| 135 | Ga0466708_272710 | 3300042652 | Bacteria | 13708 |
| 136 | Ga0466708_285223 | 3300042652 | Bacteria | 3208 |
| 137 | Ga0466708_300512 | 3300042652 | Bacteria | 25602 |
| 138 | Ga0466707_368818 | 3300042601 | Bacteria | 1152 |
| 139 | Ga0466716_259224 | 3300042605 | Bacteria | 1243 |
| 140 | Ga0466716_259275 | 3300042605 | Bacteria | 1243 |
| 141 | Ga0466696_386935 | 3300042596 | Bacteria | 3161 |
| 142 | Ga0466699_235424 | 3300042597 | Bacteria | 1323 |
| 143 | Ga0466699_272518 | 3300042597 | Bacteria | 2695 |
| 144 | Ga0466699_408784 | 3300042597 | Bacteria | 1514 |
| 145 | Ga0466705_488410 | 3300042612 | Bacteria | 10114 |
| 146 | Ga0466711_034975 | 3300042615 | Bacteria | 2096 |
| 147 | Ga0466715_082144 | 3300042616 | Bacteria | 3876 |
| 148 | Ga0466715_326352 | 3300042616 | Bacteria | 2991 |
| 149 | Ga0466715_610283 | 3300042616 | Bacteria | 4088 |
| 150 | Ga0466715_644262 | 3300042616 | Bacteria | 2493 |
| 151 | Ga0466723_208593 | 3300042618 | Bacteria | 4916 |
| 152 | Ga0466723_368796 | 3300042618 | Bacteria | 9685 |
| 153 | Ga0466726_100186 | 3300042619 | Bacteria | 3096 |
| 154 | Ga0466729_039230 | 3300042621 | Bacteria | 2295 |
| 155 | Ga0466733_000522 | 3300042659 | Bacteria | 14411 |
| 156 | Ga0466703_312856 | 3300042636 | Bacteria | 8452 |
| 157 | Ga0466704_285716 | 3300042643 | Bacteria | 16988 |
| 158 | Ga0466709_289449 | 3300042648 | Bacteria | 4555 |
| 159 | Ga0466708_044280 | 3300042652 | Bacteria | 6189 |
| 160 | Ga0466708_117239 | 3300042652 | Bacteria | 10225 |
| 161 | Ga0466719_210317 | 3300042606 | Bacteria | 22153 |
| 162 | Ga0466692_134101 | 3300042591 | Bacteria | 2539 |
| 163 | Ga0466691_082387 | 3300042593 | Bacteria | 9078 |
| 164 | Ga0466691_087674 | 3300042593 | Bacteria | 4463 |
| 165 | Ga0466696_124534 | 3300042596 | Bacteria | 1544 |
| 166 | Ga0466696_286223 | 3300042596 | Bacteria | 1295 |
| 167 | Ga0466699_105930 | 3300042597 | Bacteria | 22374 |
| 168 | Ga0466715_298930 | 3300042616 | Bacteria | 14048 |
| 169 | Ga0466723_062536 | 3300042618 | Bacteria | 6753 |
| 170 | Ga0466723_290929 | 3300042618 | Bacteria | 5591 |
| 171 | Ga0466723_348408 | 3300042618 | Bacteria | 3527 |
| 172 | Ga0466726_232993 | 3300042619 | Bacteria | 2130 |
| 173 | Ga0466728_151404 | 3300042620 | Bacteria | 16328 |
| 174 | Ga0466733_071294 | 3300042659 | Bacteria | 40111 |
| 175 | Ga0466735_102885 | 3300042624 | Bacteria | 4101 |
| 176 | Ga0466735_109197 | 3300042624 | Bacteria | 7070 |
| 177 | Ga0466703_293345 | 3300042636 | Unclassified | 5464 |
| 178 | Ga0466704_241930 | 3300042643 | Bacteria | 2257 |
| 179 | Ga0466709_188338 | 3300042648 | Bacteria | 6737 |
| 180 | Ga0466707_311616 | 3300042601 | Bacteria | 1738 |
| 181 | Ga0466707_399800 | 3300042601 | Bacteria | 1466 |
| 182 | Ga0466690_278062 | 3300042590 | Bacteria | 2795 |
| 183 | Ga0466690_417852 | 3300042590 | Bacteria | 1772 |
| 184 | Ga0466692_133384 | 3300042591 | Bacteria | 5411 |
| 185 | Ga0466691_127935 | 3300042593 | Bacteria | 2888 |
| 186 | Ga0466696_295739 | 3300042596 | Bacteria | 2158 |
| 187 | Ga0466699_130581 | 3300042597 | Bacteria | 4161 |
| 188 | Ga0466699_220851 | 3300042597 | Bacteria | 1694 |
| 189 | Ga0123354_10248876 | 3300010882 | Unclassified | 1807 |
| 190 | Ga0466715_640498 | 3300042616 | Bacteria | 7163 |
| 191 | Ga0466723_081317 | 3300042618 | Bacteria | 36983 |
| 192 | Ga0466723_100905 | 3300042618 | Bacteria | 13161 |
| 193 | Ga0466723_263688 | 3300042618 | Bacteria | 4369 |
| 194 | Ga0466726_381324 | 3300042619 | Bacteria | 2462 |
| 195 | Ga0123357_10000299 | 3300009784 | Bacteria | 47335 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF04392 | ABC_sub_bind | ABC transporter substrate binding protein | 81 | 368 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.