Protein Family IF08076

Metagenome Isolate
127 Members
44 Samples
116 Scaffolds
438.3 Avg Length

🧬 Representative Sequence

ID
3300042618|Ga0466723_128569|Ga0466723_128569_21114_22535
Length
473 aa
Sequence
MPYQQQEKYMKSILILSQQIMGDKMKDKEKGILQRLVSGVDRLLIFVVVLIITVGIFAIYSATTNSGTSSKYLSIQFLALGIGIIGMLVLTVFNYQYYKQFDKTVYILSILLLISVLIFGSEIRGTKGWFKFGFASFQPVEIAKLMFILTLSSFLDRRWKDAKKPLIFIGAFLILMGHLSLIMMQPDFSSTLSYLPVTLVLLYLIGIEPFYLLCIIIFGALAIGIPLVNTFLKLQPVLEQNASFGGNFLSLIYEGHTGIYLVVAAVSLTFFAWWLMWKLRMRVSILYPVLITCSITFGSLASIPVEKSLKEYQRKRLVVFLNPSADPRGAGYNIIQSKIAIGSGKLLGKGFIKGTQTQLGFLPEQHTDFIFSVIGEEGGWVISQLTILFYLFFIWRALVISVEARDRYGSLVSAGLATMFAFYAIINIGMVMGIMPATGVPLVLMSYGGSSMVSSLLGVGILQSIHMRRHTYY

📊 Sample Types

Isolate 8.7%
Metagenome 91.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 31.8%
Kalotermitidae 31.8%
Termitidae 20.5%
Termopsidae 9.1%
Rhinotermitidae 4.5%
Hodotermitidae 2.3%

🌳 Taxonomy

Archaea 0
Bacteria 119
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2772190894 Unclassified Elusimicrobia Th196P4_bin33 Isolate Unclassified
2 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
3 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
4 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
5 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
6 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
7 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
8 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
9 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
10 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
11 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
12 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
13 2778260940 Unclassified Fibrobacteres Mp193P3bin36 Isolate Unclassified
14 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
15 642555172 Endomicrobium trichonymphae Rs-D17 Isolate Unclassified
16 2754412483 Unclassified Elusimicrobia Lab288P4bin38 Isolate Unclassified
17 2772190893 Unclassified Elusimicrobia Nt197P4_bin29 Isolate Unclassified
18 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
19 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
20 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
21 2772190891 Unclassified Elusimicrobia Emb289P1_bin41 Isolate Unclassified
22 2772190895 Unclassified Elusimicrobia Emb289P1_bin39 Isolate Unclassified
23 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
24 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
25 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
26 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
27 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
28 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
29 2772190889 Unclassified Elusimicrobia Cu122P5_bin43 Isolate Unclassified
30 2820721785 Unclassified Fibrobacteres Lab288P1bin58 Isolate Unclassified
31 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
32 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
33 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
34 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
35 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
36 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
37 2772190892 Unclassified Elusimicrobia Lab288P3_bin37 Isolate Unclassified
38 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
39 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
40 2754412482 Unclassified Elusimicrobia Emb289P3bin85 Isolate Unclassified
41 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
42 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
43 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
44 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466735_001420 3300042624 Bacteria 8899
2 Ga0466735_044886 3300042624 Bacteria 7691
3 Ga0466703_007133 3300042636 Bacteria 3470
4 Ga0466704_177682 3300042643 Bacteria 28567
5 Ga0466690_394362 3300042590 Bacteria 1791
6 Ga0466690_434338 3300042590 Bacteria 3842
7 Ga0466707_197862 3300042601 Bacteria 9479
8 Ga0466719_126414 3300042606 Bacteria 59815
9 JGI24698J34947_10000648 3300002449 Unclassified 16836
10 Ga0466723_325001 3300042618 Bacteria 3917
11 Ga0466705_208486 3300042612 Bacteria 71494
12 Ga0466705_211457 3300042612 Bacteria 22546
13 Ga0466735_059484 3300042624 Bacteria 12495
14 Ga0466735_201938 3300042624 Bacteria 5700
15 Ga0466703_220297 3300042636 Bacteria 23837
16 Ga0466727_110661 3300042655 Bacteria 4217
17 Ga0466727_225876 3300042655 Bacteria 3121
18 Ga0466690_029087 3300042590 Bacteria 68822
19 Ga0466690_173505 3300042590 Bacteria 8988
20 Ga0466691_065678 3300042593 Unclassified 5133
21 Ga0466696_189295 3300042596 Unclassified 22793
22 Ga0466706_217033 3300042599 Bacteria 132615
23 Ga0466707_067647 3300042601 Bacteria 4837
24 Ga0466707_308526 3300042601 Bacteria 6849
25 Ga0466707_315151 3300042601 Bacteria 79442
26 Ga0466716_400985 3300042605 Bacteria 5353
27 Ga0466719_040967 3300042606 Bacteria 2782
28 Ga0068305_10000079 3300005083 Bacteria 163717
29 Ga0466715_158630 3300042616 Bacteria 22211
30 Ga0466715_292561 3300042616 Bacteria 14999
31 Ga0466715_447962 3300042616 Unclassified 11377
32 Ga0466723_055375 3300042618 Bacteria 3566
33 Ga0466723_091919 3300042618 Bacteria 27263
34 Ga0466728_411352 3300042620 Bacteria 26274
35 Ga0466729_129641 3300042621 Bacteria 24606
36 Ga0466703_094842 3300042636 Bacteria 32537
37 Ga0466727_271147 3300042655 Bacteria 176023
38 Ga0123357_10022015 3300009784 Bacteria 8540
39 Ga0466690_127221 3300042590 Unclassified 4022
40 Ga0466690_230957 3300042590 Bacteria 25729
41 Ga0466716_454581 3300042605 Bacteria 19893
42 Ga0068305_10001287 3300005083 Bacteria 40663
43 Ga0068305_10001382 3300005083 Bacteria 35132
44 Ga0068305_10005361 3300005083 Bacteria 24001
45 Ga0466715_436492 3300042616 Bacteria 169505
46 Ga0466723_195741 3300042618 Bacteria 6670
47 Ga0466704_375586 3300042643 Bacteria 37503
48 Ga0466727_214209 3300042655 Bacteria 66628
49 Ga0466706_016612 3300042599 Bacteria 25546
50 Ga0466706_166478 3300042599 Bacteria 103376
51 JGI24705J35276_12238808 3300002504 Bacteria 121301
52 Ga0068305_10001840 3300005083 Bacteria 12768
53 Ga0466726_172880 3300042619 Bacteria 24710
54 Ga0466729_035403 3300042621 Bacteria 3991
55 Ga0466729_038350 3300042621 Bacteria 15638
56 Ga0466729_154929 3300042621 Bacteria 7863
57 Ga0466727_059455 3300042655 Bacteria 175715
58 Ga0466690_369118 3300042590 Bacteria 28017
59 Ga0466706_037575 3300042599 Bacteria 87054
60 Ga0466706_093897 3300042599 Bacteria 41180
61 Ga0466707_063131 3300042601 Bacteria 29958
62 Ga0466713_104587 3300042602 Bacteria 60209
63 Ga0466714_135782 3300042603 Bacteria 52371
64 Ga0466719_172731 3300042606 Bacteria 15347
65 Ga0466711_134125 3300042615 Bacteria 100014
66 Ga0466723_180228 3300042618 Bacteria 22722
67 Ga0466726_208743 3300042619 Bacteria 3537
68 Ga0466728_355312 3300042620 Bacteria 41370
69 Ga0466729_268858 3300042621 Bacteria 59050
70 Ga0466735_049520 3300042624 Bacteria 3765
71 Ga0466704_379821 3300042643 Bacteria 15704
72 Ga0466704_591830 3300042643 Bacteria 37928
73 Ga0466727_322139 3300042655 Bacteria 101886
74 Ga0466691_226264 3300042593 Bacteria 41880
75 Ga0466707_229920 3300042601 Bacteria 5638
76 Ga0466713_092327 3300042602 Bacteria 48279
77 Ga0466712_181605 3300042614 Bacteria 3795
78 Ga0466711_372501 3300042615 Bacteria 489210
79 Ga0466711_376431 3300042615 Bacteria 48940
80 Ga0466715_046636 3300042616 Bacteria 70768
81 Ga0466715_335506 3300042616 Bacteria 2953
82 Ga0466726_428214 3300042619 Bacteria 5500
83 Ga0466728_011302 3300042620 Bacteria 42378
84 Ga0466705_029401 3300042612 Bacteria 1939
85 Ga0466735_201674 3300042624 Bacteria 26620
86 Ga0466704_174075 3300042643 Unclassified 5444
87 Ga0466704_375208 3300042643 Bacteria 49491
88 Ga0123357_10008439 3300009784 Bacteria 12865
89 Ga0123355_10004968 3300009826 Bacteria 19362
90 Ga0466713_059453 3300042602 Bacteria 25190
91 Ga0466719_130653 3300042606 Bacteria 158630
92 Ga0466719_148583 3300042606 Bacteria 2322
93 Ga0466722_155384 3300042609 Bacteria 6710
94 Ga0466715_256894 3300042616 Bacteria 26066
95 Ga0466723_128569 3300042618 Bacteria 22727
96 Ga0466726_303540 3300042619 Bacteria 65545
97 Ga0466726_387678 3300042619 Bacteria 397429
98 Ga0466703_110964 3300042636 Bacteria 165564
99 Ga0466709_030872 3300042648 Unclassified 64105
100 Ga0466708_279490 3300042652 Bacteria 27725
101 Ga0466727_170785 3300042655 Bacteria 1806
102 Ga0123355_10165101 3300009826 Bacteria 3325
103 Ga0123353_10000666 3300010167 Bacteria 41976
104 Ga0466690_129789 3300042590 Bacteria 30239
105 Ga0466694_351984 3300042594 Bacteria 2960
106 Ga0466696_029290 3300042596 Bacteria 39093
107 Ga0466706_144566 3300042599 Bacteria 12471
108 Ga0466716_126380 3300042605 Bacteria 28858
109 Ga0466716_213939 3300042605 Bacteria 5125
110 JGI24702J35022_10002376 3300002462 Bacteria 11512
111 Ga0068302_10014040 3300005071 Unclassified 3529
112 Ga0466711_400964 3300042615 Bacteria 5228
113 Ga0466715_228690 3300042616 Bacteria 3891
114 Ga0466726_077377 3300042619 Bacteria 33283
115 Ga0466726_317531 3300042619 Bacteria 2068
116 Ga0466728_151666 3300042620 Bacteria 23701

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01098 FTSW_RODA_SPOVE Cell cycle protein 266 469 0.86

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.