Protein Family IF08070
Metagenome
Isolate
130
Members
52
Samples
125
Scaffolds
421.29
Avg Length
Representative Sequence
- ID
- 3300042618|Ga0466723_119125|Ga0466723_119125_20325_21734
- Length
- 469 aa
- Sequence
- MKKKKSVKYKENKESKNEFFVSDNGENYMSQMIVSYDYKNRIEESNIINRIKDIYSKVEIDYSWSFSNATRKDTTYITHGYHRYPAKFIPQVVSRLITQYTKEGDFVVDPFGGCGTTVLEAKVMGRNSLGVDINPVATLIAKSKMTVIEPKKLEIEFNILKDKLALYNEKIYIKLPAHDRIDYWFRYEEKKELAFILSKISEIREKDIKDFFYCAFSNILKNCSIWMQKSNKPTRDFTKIPSNPIPTFYKQVKMMTRGNQNLYTLLQKKSFSNLSSQVSCNDARKIPVKNNSVDLIVTSPPYVTSYEYADLHQLSTLWFGYAKDLSDFRKIFIGTSYCDENKINLNSILAEQTVENLVQQDKKTAKEVSKYFSDMNQVFVEMKRMLKKGGKTCIVIGNTSLKRVEVLNAEVFTEQLLNLGFKIIDIIKREIPSKNLPSIRDENTGKFASLNTVNKKMIYPTEYILIMEK
Sample Types
Isolate
3.9%
Metagenome
96.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.2%
Kalotermitidae
27.5%
Blattidae
7.8%
Unclassified
7.8%
Rhinotermitidae
5.9%
Termopsidae
3.9%
Apidae
2.0%
Hodotermitidae
2.0%
Passalidae
2.0%
Taxonomy
Archaea
4
Bacteria
106
Eukaryota
0
Viruses
1
Unclassified
19
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 12 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 13 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 14 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 15 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 16 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 17 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 18 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 19 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 20 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 21 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 22 | 2740892546 | Fibrobacteria bacterium GUT307 IN01_307 | Isolate | Unclassified |
| 23 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 24 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 25 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 26 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 27 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 28 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 29 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 30 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 31 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 32 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 33 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 34 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 35 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 36 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 37 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 38 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 39 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 40 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 41 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 42 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 43 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 44 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 45 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 46 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 47 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 48 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 49 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 50 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 51 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 52 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_448002 | 3300042656 | Unclassified | 5606 |
| 2 | Ga0466733_153229 | 3300042659 | Bacteria | 1735 |
| 3 | Ga0466712_208424 | 3300042614 | Bacteria | 1675 |
| 4 | Ga0466715_001526 | 3300042616 | Bacteria | 21571 |
| 5 | Ga0466715_268288 | 3300042616 | Bacteria | 11392 |
| 6 | Ga0466726_380488 | 3300042619 | Bacteria | 1517 |
| 7 | Ga0466716_183453 | 3300042605 | Bacteria | 10612 |
| 8 | Ga0466716_437092 | 3300042605 | Bacteria | 3157 |
| 9 | Ga0466698_413289 | 3300042610 | Unclassified | 1560 |
| 10 | Ga0415639_062012 | 3300038395 | Bacteria | 3925 |
| 11 | Ga0415639_294328 | 3300038395 | Archaea | 1539 |
| 12 | Ga0466690_164219 | 3300042590 | Bacteria | 16316 |
| 13 | Ga0466692_135060 | 3300042591 | Bacteria | 4333 |
| 14 | HBC_ctgsDRAFT_1000830 | 3300000333 | Bacteria | 6808 |
| 15 | JGI24695J34938_10015651 | 3300002450 | Bacteria | 3886 |
| 16 | JGI24695J34938_10026747 | 3300002450 | Bacteria | 2737 |
| 17 | Ga0068305_10016380 | 3300005083 | Archaea | 7391 |
| 18 | Ga0466729_315737 | 3300042621 | Bacteria | 1910 |
| 19 | Ga0466735_209234 | 3300042624 | Unclassified | 2161 |
| 20 | Ga0466703_142659 | 3300042636 | Bacteria | 3069 |
| 21 | Ga0466709_016043 | 3300042648 | Bacteria | 8903 |
| 22 | Ga0466709_088510 | 3300042648 | Bacteria | 11094 |
| 23 | Ga0466708_168455 | 3300042652 | Bacteria | 4641 |
| 24 | Ga0466732_181964 | 3300042656 | Unclassified | 6714 |
| 25 | Ga0466732_280233 | 3300042656 | Bacteria | 2778 |
| 26 | Ga0466711_031367 | 3300042615 | Bacteria | 10487 |
| 27 | Ga0466718_052859 | 3300042617 | Bacteria | 8565 |
| 28 | Ga0123356_10147452 | 3300010049 | Unclassified | 2330 |
| 29 | Ga0123354_10025720 | 3300010882 | Bacteria | 9283 |
| 30 | Ga0466706_019861 | 3300042599 | Bacteria | 3534 |
| 31 | Ga0466690_190657 | 3300042590 | Bacteria | 4999 |
| 32 | Ga0466696_350741 | 3300042596 | Bacteria | 1658 |
| 33 | HBC_ctgsDRAFT_1000659 | 3300000333 | Bacteria | 7671 |
| 34 | JGI24698J34947_10010920 | 3300002449 | Unclassified | 4983 |
| 35 | JGI24705J35276_12238812 | 3300002504 | Bacteria | 178401 |
| 36 | Ga0072941_1056599 | 3300005201 | Bacteria | 5158 |
| 37 | Ga0072941_1079975 | 3300005201 | Unclassified | 2868 |
| 38 | Ga0466703_037057 | 3300042636 | Bacteria | 27981 |
| 39 | Ga0466709_112969 | 3300042648 | Bacteria | 11349 |
| 40 | Ga0466724_13846 | 3300042649 | Bacteria | 3195 |
| 41 | Ga0466708_204247 | 3300042652 | Unclassified | 4808 |
| 42 | Ga0466705_072580 | 3300042612 | Bacteria | 1516 |
| 43 | Ga0466711_168180 | 3300042615 | Bacteria | 36443 |
| 44 | Ga0466711_192693 | 3300042615 | Bacteria | 5980 |
| 45 | Ga0466729_071482 | 3300042621 | Bacteria | 1263 |
| 46 | Ga0123356_10225586 | 3300010049 | Bacteria | 1934 |
| 47 | Ga0466692_188884 | 3300042591 | Bacteria | 1685 |
| 48 | JGI24695J34938_10024930 | 3300002450 | Bacteria | 2866 |
| 49 | Ga0072941_1052289 | 3300005201 | Bacteria | 1685 |
| 50 | Ga0466703_144848 | 3300042636 | Unclassified | 8807 |
| 51 | Ga0466703_377712 | 3300042636 | Bacteria | 5137 |
| 52 | Ga0466704_016765 | 3300042643 | Bacteria | 5105 |
| 53 | Ga0466709_345527 | 3300042648 | Bacteria | 65587 |
| 54 | Ga0466709_371389 | 3300042648 | Bacteria | 6371 |
| 55 | Ga0466711_226552 | 3300042615 | Unclassified | 3398 |
| 56 | Ga0466715_442773 | 3300042616 | Bacteria | 4766 |
| 57 | Ga0466726_245007 | 3300042619 | Viruses | 4690 |
| 58 | Ga0123356_10243438 | 3300010049 | Bacteria | 1871 |
| 59 | Ga0123353_10200208 | 3300010167 | Bacteria | 3143 |
| 60 | Ga0466701_023129 | 3300042598 | Bacteria | 4718 |
| 61 | Ga0466713_132067 | 3300042602 | Bacteria | 73593 |
| 62 | Ga0466698_032383 | 3300042610 | Bacteria | 2101 |
| 63 | Ga0466691_082219 | 3300042593 | Bacteria | 62191 |
| 64 | Ga0466699_002238 | 3300042597 | Bacteria | 8428 |
| 65 | Ga0072940_1046532 | 3300005200 | Bacteria | 3705 |
| 66 | Ga0072941_1013752 | 3300005201 | Bacteria | 45793 |
| 67 | Ga0466703_383143 | 3300042636 | Bacteria | 3361 |
| 68 | Ga0466705_089453 | 3300042612 | Bacteria | 4893 |
| 69 | Ga0466705_475073 | 3300042612 | Bacteria | 3379 |
| 70 | Ga0466710_334714 | 3300042613 | Bacteria | 11852 |
| 71 | Ga0466711_300125 | 3300042615 | Bacteria | 7348 |
| 72 | Ga0466715_137071 | 3300042616 | Bacteria | 4390 |
| 73 | Ga0466695_186633 | 3300042595 | Bacteria | 1483 |
| 74 | Ga0466696_178166 | 3300042596 | Bacteria | 26972 |
| 75 | Ga0466699_030197 | 3300042597 | Bacteria | 2129 |
| 76 | Ga0466699_084020 | 3300042597 | Bacteria | 4810 |
| 77 | AustNasuHG_c1001219 | 3300000089 | Bacteria | 9261 |
| 78 | AustNasuHG_c1003213 | 3300000089 | Bacteria | 5894 |
| 79 | Ga0466703_068379 | 3300042636 | Unclassified | 8374 |
| 80 | Ga0466711_173878 | 3300042615 | Bacteria | 8231 |
| 81 | Ga0466728_096699 | 3300042620 | Bacteria | 4245 |
| 82 | Ga0466728_314011 | 3300042620 | Bacteria | 2538 |
| 83 | Ga0123356_10397719 | 3300010049 | Unclassified | 1515 |
| 84 | Ga0123354_10001356 | 3300010882 | Unclassified | 29401 |
| 85 | Ga0466706_122961 | 3300042599 | Bacteria | 2610 |
| 86 | Ga0466700_390976 | 3300042600 | Bacteria | 112705 |
| 87 | Ga0466707_045771 | 3300042601 | Bacteria | 12792 |
| 88 | Ga0466707_316082 | 3300042601 | Bacteria | 1987 |
| 89 | Ga0466707_370484 | 3300042601 | Bacteria | 2865 |
| 90 | Ga0466716_004636 | 3300042605 | Unclassified | 4978 |
| 91 | Ga0466722_085710 | 3300042609 | Archaea | 5127 |
| 92 | Ga0466699_104470 | 3300042597 | Unclassified | 4081 |
| 93 | JGI24698J34947_10010504 | 3300002449 | Bacteria | 5081 |
| 94 | Ga0072941_1015311 | 3300005201 | Bacteria | 5488 |
| 95 | Ga0072941_1052290 | 3300005201 | Bacteria | 1639 |
| 96 | Ga0466733_147851 | 3300042659 | Bacteria | 9886 |
| 97 | Ga0466712_074417 | 3300042614 | Bacteria | 8320 |
| 98 | Ga0466712_110373 | 3300042614 | Bacteria | 4736 |
| 99 | Ga0466711_039309 | 3300042615 | Unclassified | 5149 |
| 100 | Ga0466715_033190 | 3300042616 | Bacteria | 11009 |
| 101 | Ga0466718_000736 | 3300042617 | Unclassified | 1843 |
| 102 | Ga0466726_310977 | 3300042619 | Bacteria | 5865 |
| 103 | Ga0466698_500829 | 3300042610 | Bacteria | 5706 |
| 104 | Ga0466696_370161 | 3300042596 | Bacteria | 4664 |
| 105 | IMNBL1DRAFT_c0015519 | 3300000062 | Unclassified | 3304 |
| 106 | JGI24695J34938_10005775 | 3300002450 | Bacteria | 7616 |
| 107 | Ga0072941_1001538 | 3300005201 | Bacteria | 43465 |
| 108 | Ga0072941_1017921 | 3300005201 | Bacteria | 4646 |
| 109 | Ga0466703_020533 | 3300042636 | Archaea | 3803 |
| 110 | Ga0466703_076265 | 3300042636 | Bacteria | 5632 |
| 111 | Ga0466704_090115 | 3300042643 | Bacteria | 5500 |
| 112 | Ga0466732_090588 | 3300042656 | Bacteria | 6844 |
| 113 | Ga0466712_255856 | 3300042614 | Bacteria | 7030 |
| 114 | Ga0466723_119125 | 3300042618 | Bacteria | 64079 |
| 115 | Ga0123356_10000608 | 3300010049 | Bacteria | 39527 |
| 116 | Ga0123353_10148861 | 3300010167 | Bacteria | 3740 |
| 117 | Ga0466719_552616 | 3300042606 | Bacteria | 2319 |
| 118 | Ga0466698_434008 | 3300042610 | Unclassified | 4370 |
| 119 | Ga0415639_038610 | 3300038395 | Bacteria | 4895 |
| 120 | Ga0415639_218276 | 3300038395 | Bacteria | 1387 |
| 121 | JGI24702J35022_10037321 | 3300002462 | Bacteria | 2595 |
| 122 | Ga0068305_10119613 | 3300005083 | Bacteria | 6123 |
| 123 | Ga0466704_271763 | 3300042643 | Bacteria | 2059 |
| 124 | Ga0466709_013510 | 3300042648 | Bacteria | 3658 |
| 125 | Ga0466708_147395 | 3300042652 | Bacteria | 7342 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01555 | N6_N4_Mtase | DNA methylase | 293 | 469 | 0.89 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.