Protein Family IF08061
Metagenome
Isolate
294
Members
86
Samples
264
Scaffolds
271.69
Avg Length
Representative Sequence
- ID
- 3300042618|Ga0466723_110051|Ga0466723_110051_3861_4769
- Length
- 302 aa
- Sequence
- MSRSAKRPRQAPGPHPRKRGSGGRMLSYIERKSPVHALAGAVKFIVFLLWSILTMAGYDTRVMAVMAGLGLLLFFISRIKFREAASIFKVMSVFLALNLAAVYLFAPEQGVAVYHSRHVILEGAGRFTLTAEQLFYEFNIFLKYIMIIPPAILLMVCTHPSEFAASLNRIGLPYTIAYAVSLTMRYVPDVQRDYETISQAQQARGIELAKRRSDGKRVSPLKRLRGSVRLLLPLIFSSLDRIDVVSHALELRGFGKHKKRTWYSARPFSAADIAVLAAASLLFALGLWVTFKDGDRFYNPFL
Sample Types
Isolate
10.2%
Metagenome
89.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
32.5%
Unclassified
18.1%
Kalotermitidae
16.9%
Blattidae
10.8%
Tenebrionidae
6.0%
Rhinotermitidae
3.6%
Termopsidae
3.6%
Elmidae
2.4%
Hodotermitidae
1.2%
Apidae
1.2%
Blaberidae
1.2%
Scarabaeidae
1.2%
Nephropidae
1.2%
Taxonomy
Archaea
0
Bacteria
282
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940419646 | Paenibacillus sp. PastF-4 | Isolate | Blattidae |
| 2 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 3 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 4 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 5 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 6 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 7 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 8 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 9 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 10 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 11 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 12 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 13 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 14 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 15 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 16 | 2940400224 | Paenibacillus sp. PastM-2 | Isolate | Blattidae |
| 17 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 18 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 19 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 20 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 21 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 22 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 23 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 24 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 25 | 8017458139 | Lactobacillus johnsonii CRL1647 | Isolate | Apidae |
| 26 | 8018794549 | Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 | Isolate | |
| 27 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 28 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 29 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 30 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 31 | 2864801025 | Bacillus aerius S00042 | Isolate | Elmidae |
| 32 | 2940393498 | Paenibacillus sp. PastF-2 | Isolate | Blattidae |
| 33 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 34 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 35 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 36 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 37 | 2940380068 | Paenibacillus sp. PastH-2 | Isolate | Blattidae |
| 38 | 2940413413 | Paenibacillus sp. PastH-3 | Isolate | Blattidae |
| 39 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 40 | 2775507073 | Enterococcus sp. CR-Ec1 | Isolate | Unclassified |
| 41 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 42 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 43 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 44 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 45 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 46 | 2940406939 | Paenibacillus sp. PastM-3 | Isolate | Blattidae |
| 47 | 2228664004 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3b, from Florida USA | Metagenome | Termitidae |
| 48 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 49 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 50 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 51 | 8043041867 | Bacillus pumilus Ha06YP001 | Isolate | Nephropidae |
| 52 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 53 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 54 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 55 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 56 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 57 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 58 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 59 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 60 | 2622736579 | Desemzia incerta DSM 20581 | Isolate | Unclassified |
| 61 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 62 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 63 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 64 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 65 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 66 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 67 | 2940386776 | Paenibacillus sp. PastF-1 | Isolate | Blattidae |
| 68 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 69 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 70 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 71 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 72 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 73 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 74 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 75 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 76 | 2864895409 | Bacillus aerius S00152 | Isolate | Elmidae |
| 77 | 2940221333 | Paenibacillus sp. PastF-3 | Isolate | Blattidae |
| 78 | 2940425923 | Paenibacillus sp. PastH-4 | Isolate | Blattidae |
| 79 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 80 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 81 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 82 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 83 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 84 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 85 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 86 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_080687 | 3300042656 | Bacteria | 4983 |
| 2 | Ga0466732_132552 | 3300042656 | Bacteria | 1031 |
| 3 | Ga0123355_10000033 | 3300009826 | Bacteria | 138390 |
| 4 | Ga0466707_249943 | 3300042601 | Bacteria | 2333 |
| 5 | Ga0466707_357098 | 3300042601 | Bacteria | 4767 |
| 6 | Ga0466717_151119 | 3300042604 | Bacteria | 1451 |
| 7 | Ga0466716_381043 | 3300042605 | Bacteria | 1144 |
| 8 | Ga0466720_008155 | 3300042607 | Bacteria | 8569 |
| 9 | Ga0466720_014054 | 3300042607 | Bacteria | 1959 |
| 10 | Ga0466722_061399 | 3300042609 | Bacteria | 12778 |
| 11 | Ga0466722_235284 | 3300042609 | Bacteria | 7999 |
| 12 | Ga0466690_005527 | 3300042590 | Bacteria | 5812 |
| 13 | Ga0466690_058430 | 3300042590 | Bacteria | 6675 |
| 14 | Ga0466692_013191 | 3300042591 | Bacteria | 6343 |
| 15 | Ga0466692_168940 | 3300042591 | Bacteria | 4392 |
| 16 | Ga0466691_132344 | 3300042593 | Bacteria | 5885 |
| 17 | JGI24695J34938_10055004 | 3300002450 | Bacteria | 1723 |
| 18 | JGI24695J34938_10055217 | 3300002450 | Bacteria | 1718 |
| 19 | JGI24695J34938_10114707 | 3300002450 | Bacteria | 1097 |
| 20 | JGI24702J35022_10029336 | 3300002462 | Bacteria | 2953 |
| 21 | Ga0072941_1014433 | 3300005201 | Bacteria | 6692 |
| 22 | Ga0072941_1104883 | 3300005201 | Bacteria | 6126 |
| 23 | Ga0466729_197384 | 3300042621 | Bacteria | 2863 |
| 24 | Ga0466729_274941 | 3300042621 | Bacteria | 2591 |
| 25 | Ga0466702_096001 | 3300042635 | Bacteria | 1243 |
| 26 | Ga0466702_184847 | 3300042635 | Bacteria | 5306 |
| 27 | Ga0466703_125329 | 3300042636 | Bacteria | 29013 |
| 28 | Ga0466708_420759 | 3300042652 | Bacteria | 58319 |
| 29 | Ga0466727_059950 | 3300042655 | Bacteria | 3274 |
| 30 | Ga0466727_080803 | 3300042655 | Bacteria | 4194 |
| 31 | Ga0466727_267558 | 3300042655 | Bacteria | 2378 |
| 32 | Ga0466712_192768 | 3300042614 | Bacteria | 48341 |
| 33 | Ga0466711_167507 | 3300042615 | Bacteria | 2704 |
| 34 | Ga0466711_417599 | 3300042615 | Bacteria | 2331 |
| 35 | Ga0466715_058779 | 3300042616 | Bacteria | 37907 |
| 36 | Ga0466718_039644 | 3300042617 | Unclassified | 1351 |
| 37 | Ga0466726_289483 | 3300042619 | Bacteria | 1192 |
| 38 | Ga0466732_208042 | 3300042656 | Bacteria | 8600 |
| 39 | Ga0466733_153995 | 3300042659 | Bacteria | 1638 |
| 40 | Ga0466733_210322 | 3300042659 | Bacteria | 2592 |
| 41 | Ga0123353_10811264 | 3300010167 | Bacteria | 1290 |
| 42 | Ga0466706_200144 | 3300042599 | Bacteria | 1753 |
| 43 | Ga0466716_115545 | 3300042605 | Bacteria | 1897 |
| 44 | Ga0466716_414463 | 3300042605 | Bacteria | 3055 |
| 45 | Ga0466719_419289 | 3300042606 | Bacteria | 1420 |
| 46 | Ga0466719_534421 | 3300042606 | Bacteria | 9712 |
| 47 | Ga0466720_060753 | 3300042607 | Bacteria | 13317 |
| 48 | Ga0466720_095557 | 3300042607 | Bacteria | 9381 |
| 49 | Ga0466722_182069 | 3300042609 | Bacteria | 5336 |
| 50 | Ga0466698_059652 | 3300042610 | Unclassified | 7958 |
| 51 | Ga0264413_142767 | 3300024493 | Bacteria | 1953 |
| 52 | Ga0466692_121650 | 3300042591 | Bacteria | 1158 |
| 53 | Ga0466694_026496 | 3300042594 | Bacteria | 10215 |
| 54 | Ga0466699_166275 | 3300042597 | Bacteria | 1426 |
| 55 | Ga0466699_337684 | 3300042597 | Bacteria | 2889 |
| 56 | AustNasuHG_c1015310 | 3300000089 | Bacteria | 2590 |
| 57 | AustNasuHG_c1015573 | 3300000089 | Bacteria | 2563 |
| 58 | JGI24698J34947_10016527 | 3300002449 | Bacteria | 4003 |
| 59 | JGI24698J34947_10026693 | 3300002449 | Bacteria | 3068 |
| 60 | JGI24698J34947_10090517 | 3300002449 | Bacteria | 1405 |
| 61 | JGI24695J34938_10009471 | 3300002450 | Bacteria | 5414 |
| 62 | JGI24702J35022_10056195 | 3300002462 | Bacteria | 2100 |
| 63 | Ga0072940_1003463 | 3300005200 | Bacteria | 5093 |
| 64 | Ga0072940_1425073 | 3300005200 | Unclassified | 989 |
| 65 | Ga0072941_1038753 | 3300005201 | Bacteria | 4603 |
| 66 | Ga0466735_042842 | 3300042624 | Bacteria | 4407 |
| 67 | Ga0466735_220687 | 3300042624 | Bacteria | 8810 |
| 68 | Ga0466702_354071 | 3300042635 | Bacteria | 21255 |
| 69 | Ga0466709_077102 | 3300042648 | Bacteria | 85274 |
| 70 | Ga0466727_119999 | 3300042655 | Bacteria | 1290 |
| 71 | Ga0466727_131297 | 3300042655 | Unclassified | 1468 |
| 72 | Ga0466715_004131 | 3300042616 | Bacteria | 27905 |
| 73 | Ga0466726_094004 | 3300042619 | Bacteria | 3020 |
| 74 | Ga0466726_306401 | 3300042619 | Bacteria | 1104 |
| 75 | Ga0466732_008750 | 3300042656 | Bacteria | 4117 |
| 76 | Ga0466732_109018 | 3300042656 | Bacteria | 8072 |
| 77 | Ga0123356_10262475 | 3300010049 | Bacteria | 1812 |
| 78 | Ga0123356_10295675 | 3300010049 | Bacteria | 1722 |
| 79 | Ga0466716_073641 | 3300042605 | Bacteria | 7197 |
| 80 | Ga0466719_328193 | 3300042606 | Bacteria | 5469 |
| 81 | Ga0466722_215789 | 3300042609 | Bacteria | 5668 |
| 82 | Ga0466722_254906 | 3300042609 | Bacteria | 1162 |
| 83 | Ga0264413_102904 | 3300024493 | Bacteria | 15497 |
| 84 | Ga0466691_056405 | 3300042593 | Bacteria | 4711 |
| 85 | Ga0466699_084827 | 3300042597 | Bacteria | 3786 |
| 86 | Ga0466701_013149 | 3300042598 | Bacteria | 1111 |
| 87 | JGI24698J34947_10022868 | 3300002449 | Bacteria | 3348 |
| 88 | JGI24695J34938_10000042 | 3300002450 | Bacteria | 95222 |
| 89 | JGI24695J34938_10010792 | 3300002450 | Bacteria | 4968 |
| 90 | JGI24695J34938_10017373 | 3300002450 | Bacteria | 3625 |
| 91 | JGI24699J35502_11131491 | 3300002509 | Bacteria | 5749 |
| 92 | Ga0072940_1105415 | 3300005200 | Bacteria | 1386 |
| 93 | Ga0072941_1003453 | 3300005201 | Bacteria | 10168 |
| 94 | Ga0072941_1058028 | 3300005201 | Bacteria | 6244 |
| 95 | Ga0466735_188576 | 3300042624 | Bacteria | 2303 |
| 96 | Ga0466703_150682 | 3300042636 | Bacteria | 44505 |
| 97 | Ga0466727_136602 | 3300042655 | Bacteria | 7996 |
| 98 | Ga0466727_276253 | 3300042655 | Bacteria | 1406 |
| 99 | Ga0466727_295326 | 3300042655 | Bacteria | 2599 |
| 100 | Ga0466712_128028 | 3300042614 | Bacteria | 17639 |
| 101 | Ga0466712_195148 | 3300042614 | Bacteria | 34102 |
| 102 | Ga0466711_028120 | 3300042615 | Bacteria | 2253 |
| 103 | Ga0466715_510456 | 3300042616 | Bacteria | 4048 |
| 104 | Ga0466715_534731 | 3300042616 | Bacteria | 6629 |
| 105 | Ga0466723_248410 | 3300042618 | Bacteria | 2072 |
| 106 | Ga0466728_099608 | 3300042620 | Bacteria | 1613 |
| 107 | Ga0466733_021955 | 3300042659 | Bacteria | 13737 |
| 108 | Ga0466733_149910 | 3300042659 | Bacteria | 4587 |
| 109 | Ga0562379_0351 | 3300056790 | Unclassified | 109259 |
| 110 | Ga0562374_0003 | 3300057007 | Bacteria | 3497630 |
| 111 | Ga0466706_237042 | 3300042599 | Bacteria | 3959 |
| 112 | Ga0466700_449185 | 3300042600 | Bacteria | 1080 |
| 113 | Ga0466719_092221 | 3300042606 | Bacteria | 8565 |
| 114 | Ga0466720_012994 | 3300042607 | Bacteria | 8401 |
| 115 | Ga0466720_171378 | 3300042607 | Bacteria | 4367 |
| 116 | Ga0466698_250452 | 3300042610 | Bacteria | 1304 |
| 117 | Ga0264413_110110 | 3300024493 | Unclassified | 3039 |
| 118 | Ga0466691_067093 | 3300042593 | Bacteria | 27867 |
| 119 | JGI24695J34938_10001404 | 3300002450 | Bacteria | 20578 |
| 120 | JGI24695J34938_10012740 | 3300002450 | Bacteria | 4445 |
| 121 | JGI24697J35500_11225459 | 3300002507 | Bacteria | 1949 |
| 122 | Ga0072940_1019643 | 3300005200 | Bacteria | 1408 |
| 123 | Ga0072940_1044577 | 3300005200 | Bacteria | 4643 |
| 124 | Ga0072941_1002917 | 3300005201 | Bacteria | 19243 |
| 125 | Ga0466705_011217 | 3300042612 | Bacteria | 4665 |
| 126 | Ga0466705_100638 | 3300042612 | Bacteria | 19365 |
| 127 | Ga0466734_130154 | 3300042623 | Bacteria | 3482 |
| 128 | Ga0466703_096549 | 3300042636 | Bacteria | 16006 |
| 129 | Ga0466703_213847 | 3300042636 | Bacteria | 8539 |
| 130 | Ga0466708_129078 | 3300042652 | Bacteria | 3910 |
| 131 | Ga0466712_180921 | 3300042614 | Bacteria | 6941 |
| 132 | Ga0466715_038885 | 3300042616 | Bacteria | 12607 |
| 133 | Ga0466718_030577 | 3300042617 | Bacteria | 14715 |
| 134 | Ga0466723_202451 | 3300042618 | Bacteria | 12166 |
| 135 | Ga0466726_139110 | 3300042619 | Bacteria | 9745 |
| 136 | Ga0466726_308292 | 3300042619 | Bacteria | 1762 |
| 137 | Ga0466733_219804 | 3300042659 | Bacteria | 1754 |
| 138 | Ga0123356_10202026 | 3300010049 | Bacteria | 2028 |
| 139 | Ga0123356_10574306 | 3300010049 | Bacteria | 1290 |
| 140 | Ga0466707_128889 | 3300042601 | Bacteria | 11893 |
| 141 | Ga0466716_407272 | 3300042605 | Bacteria | 6127 |
| 142 | Ga0466719_035069 | 3300042606 | Bacteria | 14650 |
| 143 | Ga0466719_110192 | 3300042606 | Bacteria | 7789 |
| 144 | Ga0466719_379308 | 3300042606 | Bacteria | 31120 |
| 145 | Ga0466720_022378 | 3300042607 | Bacteria | 4741 |
| 146 | Ga0466720_160476 | 3300042607 | Bacteria | 12645 |
| 147 | Ga0466722_037308 | 3300042609 | Bacteria | 2195 |
| 148 | Ga0264413_101916 | 3300024493 | Bacteria | 12554 |
| 149 | Ga0466690_195648 | 3300042590 | Unclassified | 3448 |
| 150 | Ga0466692_157647 | 3300042591 | Bacteria | 35780 |
| 151 | Ga0466691_205184 | 3300042593 | Bacteria | 20801 |
| 152 | Ga0466696_155253 | 3300042596 | Bacteria | 19714 |
| 153 | Ga0466699_443634 | 3300042597 | Bacteria | 28955 |
| 154 | JGI24695J34938_10000043 | 3300002450 | Bacteria | 94696 |
| 155 | JGI24695J34938_10000317 | 3300002450 | Bacteria | 47269 |
| 156 | JGI24697J35500_11199637 | 3300002507 | Bacteria | 1659 |
| 157 | Ga0072940_1019642 | 3300005200 | Bacteria | 1509 |
| 158 | Ga0072940_1019644 | 3300005200 | Bacteria | 1930 |
| 159 | Ga0466705_076428 | 3300042612 | Bacteria | 3534 |
| 160 | Ga0466735_144114 | 3300042624 | Bacteria | 1298 |
| 161 | Ga0466709_176764 | 3300042648 | Bacteria | 1748 |
| 162 | Ga0466709_369471 | 3300042648 | Bacteria | 1723 |
| 163 | Ga0466708_011305 | 3300042652 | Bacteria | 3243 |
| 164 | Ga0466708_349412 | 3300042652 | Bacteria | 1414 |
| 165 | Ga0466712_259879 | 3300042614 | Bacteria | 13634 |
| 166 | Ga0466711_179587 | 3300042615 | Bacteria | 1617 |
| 167 | Ga0466711_406384 | 3300042615 | Bacteria | 14293 |
| 168 | Ga0466715_285090 | 3300042616 | Bacteria | 12088 |
| 169 | Ga0466718_059207 | 3300042617 | Bacteria | 5097 |
| 170 | Ga0466723_072326 | 3300042618 | Bacteria | 29079 |
| 171 | Ga0466723_155540 | 3300042618 | Bacteria | 2025 |
| 172 | Ga0466726_271510 | 3300042619 | Bacteria | 1346 |
| 173 | Ga0466726_437933 | 3300042619 | Bacteria | 3378 |
| 174 | Ga0466728_370765 | 3300042620 | Bacteria | 7459 |
| 175 | Ga0466729_130161 | 3300042621 | Bacteria | 1530 |
| 176 | Ga0466733_021704 | 3300042659 | Bacteria | 11735 |
| 177 | Ga0466733_135580 | 3300042659 | Bacteria | 1627 |
| 178 | Ga0562376_0074 | 3300056857 | Bacteria | 238659 |
| 179 | Ga0466713_059062 | 3300042602 | Bacteria | 88440 |
| 180 | Ga0466716_203114 | 3300042605 | Bacteria | 6671 |
| 181 | Ga0466716_341416 | 3300042605 | Bacteria | 27694 |
| 182 | Ga0466719_524781 | 3300042606 | Bacteria | 29036 |
| 183 | Ga0466720_018587 | 3300042607 | Bacteria | 1820 |
| 184 | Ga0466720_101078 | 3300042607 | Bacteria | 1608 |
| 185 | Ga0466698_191041 | 3300042610 | Bacteria | 2135 |
| 186 | Ga0264413_106559 | 3300024493 | Bacteria | 4395 |
| 187 | Ga0264413_115727 | 3300024493 | Bacteria | 42788 |
| 188 | Ga0264413_137270 | 3300024493 | Bacteria | 7971 |
| 189 | Ga0466693_066780 | 3300042592 | Bacteria | 5065 |
| 190 | Ga0466693_276385 | 3300042592 | Bacteria | 14859 |
| 191 | Ga0466691_118764 | 3300042593 | Bacteria | 8104 |
| 192 | AustNasuHG_c1000153 | 3300000089 | Bacteria | 21862 |
| 193 | JGI24698J34947_10011818 | 3300002449 | Bacteria | 4794 |
| 194 | JGI24698J34947_10021482 | 3300002449 | Bacteria | 3471 |
| 195 | JGI24698J34947_10043556 | 3300002449 | Bacteria | 2301 |
| 196 | Ga0068305_10001069 | 3300005083 | Bacteria | 26021 |
| 197 | Ga0072940_1005931 | 3300005200 | Bacteria | 28232 |
| 198 | Ga0072940_1026932 | 3300005200 | Bacteria | 1772 |
| 199 | Ga0072941_1007445 | 3300005201 | Bacteria | 8849 |
| 200 | Ga0072941_1008587 | 3300005201 | Bacteria | 6222 |
| 201 | Ga0466735_051128 | 3300042624 | Bacteria | 1947 |
| 202 | Ga0466704_433507 | 3300042643 | Bacteria | 27110 |
| 203 | Ga0466708_168232 | 3300042652 | Bacteria | 3219 |
| 204 | Ga0466708_208474 | 3300042652 | Bacteria | 6798 |
| 205 | Ga0466712_031105 | 3300042614 | Bacteria | 6966 |
| 206 | Ga0466711_013998 | 3300042615 | Bacteria | 2217 |
| 207 | Ga0466711_348955 | 3300042615 | Bacteria | 1585 |
| 208 | Ga0466715_210659 | 3300042616 | Bacteria | 15065 |
| 209 | Ga0466715_610416 | 3300042616 | Bacteria | 2918 |
| 210 | Ga0466718_022803 | 3300042617 | Bacteria | 4483 |
| 211 | Ga0466718_086242 | 3300042617 | Bacteria | 67871 |
| 212 | Ga0466723_199080 | 3300042618 | Bacteria | 8348 |
| 213 | Ga0466723_247480 | 3300042618 | Bacteria | 81364 |
| 214 | Ga0466723_356060 | 3300042618 | Unclassified | 4392 |
| 215 | Ga0466726_075096 | 3300042619 | Bacteria | 2555 |
| 216 | Ga0123356_10563605 | 3300010049 | Bacteria | 1301 |
| 217 | Ga0466713_065052 | 3300042602 | Bacteria | 1671 |
| 218 | Ga0466717_136727 | 3300042604 | Bacteria | 3388 |
| 219 | Ga0466716_176224 | 3300042605 | Bacteria | 4662 |
| 220 | Ga0466720_124760 | 3300042607 | Bacteria | 31233 |
| 221 | Ga0466690_091092 | 3300042590 | Unclassified | 3176 |
| 222 | Ga0466692_047229 | 3300042591 | Bacteria | 3743 |
| 223 | Ga0466691_089239 | 3300042593 | Bacteria | 12278 |
| 224 | Ga0466691_095340 | 3300042593 | Bacteria | 14089 |
| 225 | Ga0466694_283132 | 3300042594 | Bacteria | 2195 |
| 226 | Ga0466699_415604 | 3300042597 | Bacteria | 2926 |
| 227 | AustNasuHG_c1003978 | 3300000089 | Bacteria | 5325 |
| 228 | JGI24698J34947_10080666 | 3300002449 | Bacteria | 1528 |
| 229 | JGI24695J34938_10000009 | 3300002450 | Bacteria | 135235 |
| 230 | Ga0466697_163696 | 3300042611 | Bacteria | 2787 |
| 231 | Ga0466708_328291 | 3300042652 | Bacteria | 14728 |
| 232 | Ga0466712_026193 | 3300042614 | Bacteria | 6448 |
| 233 | Ga0466712_182380 | 3300042614 | Bacteria | 2993 |
| 234 | Ga0466718_030741 | 3300042617 | Unclassified | 1839 |
| 235 | Ga0466718_092740 | 3300042617 | Bacteria | 26065 |
| 236 | Ga0466723_063205 | 3300042618 | Bacteria | 9369 |
| 237 | Ga0466723_110051 | 3300042618 | Bacteria | 8882 |
| 238 | Ga0466723_159051 | 3300042618 | Bacteria | 7354 |
| 239 | Ga0466723_317151 | 3300042618 | Bacteria | 31919 |
| 240 | Ga0466723_340372 | 3300042618 | Unclassified | 4514 |
| 241 | Ga0562378_0100 | 3300056814 | Bacteria | 234568 |
| 242 | Ga0562375_0061 | 3300056856 | Bacteria | 434631 |
| 243 | Ga0123355_10503445 | 3300009826 | Bacteria | 1492 |
| 244 | Ga0466706_217296 | 3300042599 | Bacteria | 30204 |
| 245 | Ga0466700_392386 | 3300042600 | Bacteria | 1700 |
| 246 | Ga0466717_143450 | 3300042604 | Bacteria | 2283 |
| 247 | Ga0466719_498156 | 3300042606 | Bacteria | 69594 |
| 248 | Ga0466720_044669 | 3300042607 | Bacteria | 23520 |
| 249 | Ga0466722_092688 | 3300042609 | Bacteria | 8912 |
| 250 | Ga0466690_133639 | 3300042590 | Bacteria | 48450 |
| 251 | Ga0466691_010897 | 3300042593 | Bacteria | 19539 |
| 252 | Ga0466691_200520 | 3300042593 | Bacteria | 4822 |
| 253 | Ga0466694_156043 | 3300042594 | Bacteria | 3566 |
| 254 | Ga0466699_258354 | 3300042597 | Bacteria | 5387 |
| 255 | 2230969617 | 2228664004 | Bacteria | 10160 |
| 256 | Ga0466704_170339 | 3300042643 | Bacteria | 27113 |
| 257 | Ga0466704_495073 | 3300042643 | Bacteria | 3501 |
| 258 | Ga0466709_104383 | 3300042648 | Bacteria | 21621 |
| 259 | Ga0466705_423643 | 3300042612 | Bacteria | 6605 |
| 260 | Ga0466715_295640 | 3300042616 | Unclassified | 169413 |
| 261 | Ga0466718_138372 | 3300042617 | Bacteria | 1501 |
| 262 | Ga0466726_173709 | 3300042619 | Bacteria | 1378 |
| 263 | Ga0466728_012152 | 3300042620 | Bacteria | 2127 |
| 264 | Ga0466729_041980 | 3300042621 | Bacteria | 1498 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02361 | CbiQ | Cobalt transport protein | 32 | 259 | 0.85 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.