Protein Family IF08045
Metagenome
Isolate
130
Members
48
Samples
121
Scaffolds
114.32
Avg Length
Representative Sequence
- ID
- 3300042618|Ga0466723_087304|Ga0466723_087304_431_799
- Length
- 122 aa
- Sequence
- MKNTDAGKKASAMEYRGYYGTVGFSAADDVFFGKVAGVNSLISFEGDSVQGLRADFEGAVNDYLEMCADKGIEPEKAYKGSFNVRVSPELHKALALYSASHGKTLNSAVEEAISHYITPNNS
Sample Types
Isolate
6.9%
Metagenome
93.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
48.9%
Unclassified
21.3%
Kalotermitidae
19.1%
Rhinotermitidae
6.4%
Termopsidae
2.1%
Hodotermitidae
2.1%
Taxonomy
Archaea
0
Bacteria
117
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 2 | 2820442516 | Unclassified Firmicutes Lab288P3bin200 | Isolate | Unclassified |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 10 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 11 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 12 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 13 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 14 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 15 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 16 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 17 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 18 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 19 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 20 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 21 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 22 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 23 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 24 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 25 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 26 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 27 | 2820525019 | Unclassified Firmicutes Lab288P1bin2 | Isolate | Unclassified |
| 28 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 29 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 30 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 31 | 2820292184 | Unclassified Firmicutes Th196P3bin109 | Isolate | Unclassified |
| 32 | 2820566695 | Unclassified Firmicutes Emb289P3bin50 | Isolate | Unclassified |
| 33 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 34 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 35 | 2820483401 | Unclassified Firmicutes Lab288P1bin74 | Isolate | Unclassified |
| 36 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 37 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 38 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 39 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 40 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 41 | 2820713307 | Unclassified Firmicutes Co191P1bin2 | Isolate | Unclassified |
| 42 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 43 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 44 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 45 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 46 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 47 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 48 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_065583 | 3300042656 | Bacteria | 3366 |
| 2 | Ga0466733_087075 | 3300042659 | Bacteria | 1717 |
| 3 | Ga0123355_10033018 | 3300009826 | Bacteria | 8403 |
| 4 | Ga0123355_12041906 | 3300009826 | Bacteria | 530 |
| 5 | Ga0123353_10859528 | 3300010167 | Unclassified | 1242 |
| 6 | Ga0123353_12639532 | 3300010167 | Unclassified | 593 |
| 7 | Ga0123353_12874726 | 3300010167 | Bacteria | 562 |
| 8 | Ga0123354_10616149 | 3300010882 | Bacteria | 789 |
| 9 | Ga0466703_012647 | 3300042636 | Bacteria | 2999 |
| 10 | Ga0466724_59292 | 3300042649 | Bacteria | 2861 |
| 11 | Ga0466714_068759 | 3300042603 | Bacteria | 1581 |
| 12 | Ga0466699_394091 | 3300042597 | Bacteria | 1160 |
| 13 | JGI24695J34938_10001137 | 3300002450 | Bacteria | 23821 |
| 14 | JGI24695J34938_10018565 | 3300002450 | Bacteria | 3471 |
| 15 | JGI24695J34938_10028582 | 3300002450 | Bacteria | 2618 |
| 16 | Ga0123355_10122496 | 3300009826 | Bacteria | 4029 |
| 17 | Ga0123355_11418965 | 3300009826 | Bacteria | 685 |
| 18 | Ga0123356_10000645 | 3300010049 | Bacteria | 38373 |
| 19 | Ga0123356_13862473 | 3300010049 | Bacteria | 517 |
| 20 | Ga0123353_11603101 | 3300010167 | Bacteria | 822 |
| 21 | Ga0466723_087304 | 3300042618 | Bacteria | 11238 |
| 22 | Ga0466726_022365 | 3300042619 | Bacteria | 5856 |
| 23 | Ga0466706_218573 | 3300042599 | Bacteria | 1186 |
| 24 | Ga0466707_125901 | 3300042601 | Unclassified | 3116 |
| 25 | Ga0466717_262868 | 3300042604 | Bacteria | 1287 |
| 26 | JGI24698J34947_10018094 | 3300002449 | Bacteria | 3812 |
| 27 | JGI24695J34938_10023128 | 3300002450 | Bacteria | 3002 |
| 28 | Ga0072941_1000589 | 3300005201 | Bacteria | 53863 |
| 29 | Ga0123355_10210891 | 3300009826 | Bacteria | 2815 |
| 30 | Ga0123356_10001066 | 3300010049 | Bacteria | 30413 |
| 31 | Ga0123356_10051294 | 3300010049 | Bacteria | 3838 |
| 32 | Ga0123356_10076983 | 3300010049 | Bacteria | 3145 |
| 33 | Ga0123356_10185837 | 3300010049 | Bacteria | 2104 |
| 34 | Ga0123356_10558916 | 3300010049 | Bacteria | 1306 |
| 35 | Ga0466712_003481 | 3300042614 | Unclassified | 6349 |
| 36 | Ga0466712_287273 | 3300042614 | Bacteria | 3591 |
| 37 | Ga0466704_431417 | 3300042643 | Bacteria | 1110 |
| 38 | Ga0466725_411859 | 3300042654 | Bacteria | 15621 |
| 39 | Ga0466696_433321 | 3300042596 | Bacteria | 8702 |
| 40 | JGI24698J34947_10099841 | 3300002449 | Bacteria | 1308 |
| 41 | Ga0123357_10957668 | 3300009784 | Bacteria | 541 |
| 42 | Ga0123355_10454147 | 3300009826 | Bacteria | 1613 |
| 43 | Ga0123355_10805775 | 3300009826 | Unclassified | 1046 |
| 44 | Ga0123355_11297017 | 3300009826 | Unclassified | 731 |
| 45 | Ga0123356_12516441 | 3300010049 | Bacteria | 644 |
| 46 | Ga0123356_12826197 | 3300010049 | Bacteria | 607 |
| 47 | Ga0123353_10146558 | 3300010167 | Bacteria | 3774 |
| 48 | Ga0123353_11122428 | 3300010167 | Bacteria | 1041 |
| 49 | Ga0466711_071137 | 3300042615 | Bacteria | 1995 |
| 50 | Ga0466729_258472 | 3300042621 | Bacteria | 1264 |
| 51 | Ga0466734_064525 | 3300042623 | Bacteria | 1106 |
| 52 | Ga0466703_252443 | 3300042636 | Bacteria | 1233 |
| 53 | Ga0466708_062798 | 3300042652 | Bacteria | 20645 |
| 54 | Ga0466707_370307 | 3300042601 | Bacteria | 1771 |
| 55 | Ga0466714_067573 | 3300042603 | Bacteria | 1442 |
| 56 | Ga0466719_087512 | 3300042606 | Bacteria | 1403 |
| 57 | Ga0466693_265472 | 3300042592 | Bacteria | 1314 |
| 58 | JGI24698J34947_10055476 | 3300002449 | Bacteria | 1974 |
| 59 | JGI24695J34938_10007529 | 3300002450 | Bacteria | 6357 |
| 60 | JGI24695J34938_10042457 | 3300002450 | Bacteria | 2035 |
| 61 | Ga0466733_192228 | 3300042659 | Bacteria | 11787 |
| 62 | Ga0123355_10298499 | 3300009826 | Bacteria | 2200 |
| 63 | Ga0123355_10479757 | 3300009826 | Bacteria | 1548 |
| 64 | Ga0123355_11539444 | 3300009826 | Bacteria | 645 |
| 65 | Ga0123356_10082392 | 3300010049 | Bacteria | 3046 |
| 66 | Ga0123353_10278982 | 3300010167 | Bacteria | 2568 |
| 67 | Ga0466712_108249 | 3300042614 | Bacteria | 1426 |
| 68 | Ga0466704_010457 | 3300042643 | Bacteria | 2043 |
| 69 | Ga0466707_412373 | 3300042601 | Unclassified | 1081 |
| 70 | Ga0466714_103891 | 3300042603 | Bacteria | 2296 |
| 71 | Ga0466719_292854 | 3300042606 | Bacteria | 1059 |
| 72 | Ga0415639_051881 | 3300038395 | Bacteria | 2705 |
| 73 | Ga0072941_1075072 | 3300005201 | Bacteria | 1015 |
| 74 | Ga0466733_184940 | 3300042659 | Bacteria | 1256 |
| 75 | Ga0123357_10168809 | 3300009784 | Bacteria | 2596 |
| 76 | Ga0123356_10007236 | 3300010049 | Bacteria | 11093 |
| 77 | Ga0123356_10376448 | 3300010049 | Bacteria | 1551 |
| 78 | Ga0123356_11076542 | 3300010049 | Bacteria | 973 |
| 79 | Ga0123356_12281953 | 3300010049 | Bacteria | 677 |
| 80 | Ga0123353_10000246 | 3300010167 | Bacteria | 67982 |
| 81 | Ga0123353_10232665 | 3300010167 | Bacteria | 2871 |
| 82 | Ga0123353_11891004 | 3300010167 | Bacteria | 737 |
| 83 | Ga0466712_192768 | 3300042614 | Bacteria | 48341 |
| 84 | Ga0466722_043939 | 3300042609 | Bacteria | 5025 |
| 85 | Ga0415639_165849 | 3300038395 | Bacteria | 1893 |
| 86 | JGI24698J34947_10130353 | 3300002449 | Bacteria | 1076 |
| 87 | JGI24695J34938_10000281 | 3300002450 | Bacteria | 50109 |
| 88 | Ga0466733_175907 | 3300042659 | Bacteria | 3827 |
| 89 | Ga0123355_10293376 | 3300009826 | Bacteria | 2228 |
| 90 | Ga0123355_10339419 | 3300009826 | Bacteria | 2003 |
| 91 | Ga0123356_10032761 | 3300010049 | Bacteria | 4860 |
| 92 | Ga0123356_10099865 | 3300010049 | Bacteria | 2782 |
| 93 | Ga0123356_10166355 | 3300010049 | Unclassified | 2210 |
| 94 | Ga0123356_10231060 | 3300010049 | Bacteria | 1914 |
| 95 | Ga0123356_11538563 | 3300010049 | Bacteria | 822 |
| 96 | Ga0123353_11076729 | 3300010167 | Bacteria | 1070 |
| 97 | Ga0123353_12683032 | 3300010167 | Bacteria | 587 |
| 98 | Ga0466712_274260 | 3300042614 | Bacteria | 1873 |
| 99 | Ga0466723_167719 | 3300042618 | Bacteria | 7595 |
| 100 | Ga0466731_176732 | 3300042622 | Bacteria | 1413 |
| 101 | Ga0466706_192538 | 3300042599 | Bacteria | 2125 |
| 102 | Ga0466721_071121 | 3300042608 | Bacteria | 18194 |
| 103 | Ga0466690_222872 | 3300042590 | Bacteria | 2005 |
| 104 | Ga0466692_145195 | 3300042591 | Unclassified | 1342 |
| 105 | Ga0466692_155266 | 3300042591 | Bacteria | 7776 |
| 106 | Ga0466691_092131 | 3300042593 | Bacteria | 5964 |
| 107 | Ga0466694_103168 | 3300042594 | Bacteria | 1863 |
| 108 | AustNasuHG_c1000626 | 3300000089 | Bacteria | 12502 |
| 109 | JGI24695J34938_10009938 | 3300002450 | Bacteria | 5251 |
| 110 | JGI24695J34938_10174371 | 3300002450 | Unclassified | 888 |
| 111 | Ga0123356_12865647 | 3300010049 | Bacteria | 603 |
| 112 | Ga0123353_10238055 | 3300010167 | Unclassified | 2831 |
| 113 | Ga0123353_10960196 | 3300010167 | Bacteria | 1155 |
| 114 | Ga0123353_11632608 | 3300010167 | Bacteria | 812 |
| 115 | Ga0123353_12298691 | 3300010167 | Bacteria | 648 |
| 116 | Ga0466712_084865 | 3300042614 | Bacteria | 39681 |
| 117 | Ga0466726_176737 | 3300042619 | Unclassified | 8810 |
| 118 | Ga0466729_293239 | 3300042621 | Bacteria | 9852 |
| 119 | Ga0466717_103117 | 3300042604 | Bacteria | 1426 |
| 120 | Ga0072940_1462094 | 3300005200 | Bacteria | 788 |
| 121 | Ga0072941_1075071 | 3300005201 | Unclassified | 1331 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF05534 | HicB | HicB family | 63 | 113 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.