Protein Family IF08036

Metagenome Isolate
195 Members
51 Samples
177 Scaffolds
516.81 Avg Length

🧬 Representative Sequence

ID
3300042618|Ga0466723_073899|Ga0466723_073899_5673_7385
Length
570 aa
Sequence
MKFALQNGKKAMQRLNQVLIWLEKYKYCLSKERRFHSQLIKFYLRSLFFITIMLDNDIKQQVQGIFAGLQAKYTLDASVPVLHENRKDFEDFLTDIASTSDNIDCKINDGTQLAFLLLKNGKETGIKFRGIPSGHEFSSLILAILNSDGQGKNIPDEALINSVKALKGKINLTTYVSLACTNCPDIVQALNLMALLNNNIKHEMVDGALYQDEAAALNIQAVPSVFADGQLLHAGKSDFGTLLEKLKSYYGSEIKTDKTETKSYDVIVTGGGPSGTAAAIYSARKGLKVAIITERTGGQVNDTVGIENLISVPYTTGKQLATQLKSHIQNYEIDLLEHRRVEKIADENNKKIIFTSTGERFTAESIIIATGANWRKLNVAGESEYIGRGVAFCPHCDGPFYKGKHVAVIGGGNSGIEAAIDLSGICSKVTVLEYADNIKADIVLQENAKSRKNLEIITGVQTTEVMGNGEKVTGIAIKYRNTDKEEIINLDGIFVQIGLAANSGIFKDYVKTNKAGEIEIDEHCRTNRRGIYAAGDVTNIPYKQIIISMGEGAKAALSAFEDHIRNFSAN

📊 Sample Types

Isolate 9.2%
Metagenome 90.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 28.6%
Unclassified 22.4%
Termitidae 12.2%
Rhinotermitidae 8.2%
Termopsidae 8.2%
Passalidae 6.1%
Formicidae 6.1%
Blattidae 6.1%
Hodotermitidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 186
Eukaryota 0
Viruses 0
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
2 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
3 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
4 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
5 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
6 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
7 2843073756 Oecophyllibacter saccharovorans Jb2 Isolate Formicidae
8 2987233858 Stutzerimonas stutzeri AR9-4 Isolate Unclassified
9 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
10 2837008993 Oecophyllibacter saccharovorans Ta1 Isolate Formicidae
11 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
12 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
13 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
14 8112490586 Staphylococcus muscae CCM 4175 Isolate
15 2873597894 Erysipelothrix sp. HDW6B Isolate Unclassified
16 2917496769 Staphylococcus muscae DSM 7068 Isolate Unclassified
17 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
18 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
19 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
20 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
21 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
22 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
23 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
24 2528768159 Alteromonadaceae bacterium Bs31 Isolate Unclassified
25 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
26 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
27 3003178663 Psychrobacter fulvigenes KC-40 Isolate Unclassified
28 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
29 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
30 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
31 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
32 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
33 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
34 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
35 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
36 2841821538 Psychrobacter sp. YP14 Isolate Unclassified
37 2987037630 Oecophyllibacter saccharovorans Ha5 Isolate Formicidae
38 2997944163 Streptococcus penaeicida CAIM 1838 Isolate Unclassified
39 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
40 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
41 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
42 8012112996 Staphylococcus muscae ATCC 49910 Isolate
43 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
44 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
45 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
46 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
47 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
48 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
49 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
50 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
51 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_247701 3300042612 Bacteria 13816
2 Ga0466705_281071 3300042612 Bacteria 4109
3 Ga0466705_306668 3300042612 Bacteria 5957
4 Ga0466705_431915 3300042612 Bacteria 29542
5 Ga0466723_016888 3300042618 Bacteria 10591
6 Ga0466723_123220 3300042618 Bacteria 4036
7 Ga0466690_153303 3300042590 Bacteria 2364
8 Ga0466690_186667 3300042590 Bacteria 2620
9 Ga0466692_197900 3300042591 Bacteria 10575
10 Ga0466691_055600 3300042593 Bacteria 8718
11 Ga0466733_165496 3300042659 Bacteria 147790
12 Ga0466703_268814 3300042636 Unclassified 6154
13 Ga0466704_148962 3300042643 Bacteria 2157
14 Ga0466709_020733 3300042648 Bacteria 48670
15 Ga0466709_219765 3300042648 Bacteria 5631
16 Ga0466725_072012 3300042654 Bacteria 51081
17 Ga0466727_034358 3300042655 Bacteria 33712
18 Ga0466727_187817 3300042655 Bacteria 5702
19 Ga0466727_240512 3300042655 Bacteria 3148
20 Ga0466707_192426 3300042601 Bacteria 6724
21 Ga0466719_326780 3300042606 Bacteria 6802
22 Ga0068302_10086200 3300005071 Unclassified 3959
23 Ga0466705_226040 3300042612 Bacteria 8446
24 Ga0466711_458550 3300042615 Bacteria 5351
25 Ga0466715_099333 3300042616 Bacteria 3178
26 Ga0466715_152732 3300042616 Bacteria 63075
27 Ga0466723_073899 3300042618 Bacteria 12479
28 Ga0466723_313673 3300042618 Bacteria 69196
29 Ga0466726_012239 3300042619 Bacteria 5298
30 Ga0466690_036952 3300042590 Bacteria 8415
31 Ga0466691_041694 3300042593 Unclassified 4367
32 Ga0466691_065223 3300042593 Bacteria 5643
33 Ga0466703_202228 3300042636 Bacteria 12788
34 Ga0466704_278048 3300042643 Bacteria 35404
35 Ga0466709_352187 3300042648 Bacteria 16493
36 Ga0466708_337902 3300042652 Bacteria 34703
37 Ga0466706_003744 3300042599 Bacteria 5876
38 Ga0466707_039207 3300042601 Bacteria 20731
39 Ga0466707_230981 3300042601 Bacteria 5625
40 Ga0466719_289949 3300042606 Bacteria 14035
41 Ga0466722_074972 3300042609 Bacteria 4369
42 2227599623 2225789004 Bacteria 12562
43 Ga0466711_026436 3300042615 Bacteria 12535
44 Ga0466711_188160 3300042615 Bacteria 36997
45 Ga0466711_271880 3300042615 Bacteria 44119
46 Ga0466723_116408 3300042618 Unclassified 13439
47 Ga0466729_176421 3300042621 Bacteria 18374
48 Ga0466692_187408 3300042591 Bacteria 16849
49 Ga0466691_191729 3300042593 Bacteria 4062
50 Ga0466696_130820 3300042596 Bacteria 2566
51 Ga0466696_295741 3300042596 Bacteria 16912
52 Ga0466696_488774 3300042596 Bacteria 20217
53 Ga0466704_127785 3300042643 Bacteria 3746
54 Ga0466709_064979 3300042648 Bacteria 2185
55 Ga0466708_084846 3300042652 Bacteria 3980
56 Ga0466708_136755 3300042652 Bacteria 42794
57 Ga0466727_117113 3300042655 Bacteria 3963
58 Ga0466727_171228 3300042655 Bacteria 14015
59 Ga0466706_008283 3300042599 Bacteria 3933
60 Ga0466706_272842 3300042599 Bacteria 6549
61 Ga0466707_320253 3300042601 Bacteria 5654
62 2226983153 2225789003 Bacteria 9059
63 2227535714 2225789004 Bacteria 63282
64 Ga0466705_011389 3300042612 Bacteria 26149
65 Ga0466711_048732 3300042615 Bacteria 11043
66 Ga0466715_157210 3300042616 Bacteria 20490
67 Ga0466715_165454 3300042616 Bacteria 2920
68 Ga0466715_478390 3300042616 Bacteria 13908
69 Ga0466723_123513 3300042618 Bacteria 16564
70 Ga0466690_101169 3300042590 Bacteria 9511
71 Ga0466691_062864 3300042593 Bacteria 10343
72 Ga0466703_108464 3300042636 Bacteria 16019
73 Ga0466704_119378 3300042643 Bacteria 37210
74 Ga0466704_245786 3300042643 Bacteria 13765
75 Ga0466704_253317 3300042643 Bacteria 5002
76 Ga0466708_041079 3300042652 Bacteria 19149
77 Ga0466708_120069 3300042652 Bacteria 11945
78 Ga0466708_193294 3300042652 Bacteria 16352
79 Ga0466727_031563 3300042655 Bacteria 12423
80 Ga0466727_126115 3300042655 Bacteria 5777
81 Ga0466727_256051 3300042655 Bacteria 5473
82 Ga0466707_354973 3300042601 Bacteria 6540
83 Ga0466716_349846 3300042605 Bacteria 13854
84 Ga0466719_077234 3300042606 Unclassified 4198
85 Ga0466722_108389 3300042609 Bacteria 5696
86 IMNBL1DRAFT_c0005656 3300000062 Bacteria 7065
87 Ga0068302_10077873 3300005071 Bacteria 2450
88 Ga0068302_10098622 3300005071 Unclassified 7292
89 Ga0466697_096879 3300042611 Bacteria 330838
90 Ga0466705_235933 3300042612 Bacteria 12959
91 Ga0466711_057542 3300042615 Bacteria 70908
92 Ga0466711_398346 3300042615 Bacteria 8484
93 Ga0466723_037591 3300042618 Bacteria 8313
94 Ga0466726_300195 3300042619 Unclassified 2201
95 Ga0466690_328021 3300042590 Bacteria 13115
96 Ga0466703_083585 3300042636 Bacteria 3342
97 Ga0466704_572823 3300042643 Bacteria 27731
98 Ga0466727_319003 3300042655 Bacteria 50861
99 Ga0466713_056121 3300042602 Bacteria 24333
100 Ga0466711_403039 3300042615 Bacteria 15942
101 Ga0466715_434977 3300042616 Bacteria 19735
102 Ga0466729_097262 3300042621 Bacteria 61385
103 Ga0466690_177182 3300042590 Bacteria 15895
104 Ga0466690_368746 3300042590 Bacteria 9309
105 Ga0466709_264839 3300042648 Bacteria 9195
106 Ga0466708_154325 3300042652 Bacteria 6703
107 Ga0466725_037026 3300042654 Bacteria 49383
108 Ga0466727_277179 3300042655 Bacteria 2794
109 Ga0466706_078042 3300042599 Bacteria 3676
110 Ga0466706_079021 3300042599 Bacteria 1768
111 Ga0466713_133915 3300042602 Bacteria 7822
112 Ga0466716_183262 3300042605 Bacteria 30600
113 Ga0466716_225048 3300042605 Bacteria 4547
114 Ga0466719_133184 3300042606 Bacteria 4796
115 Ga0466719_147084 3300042606 Bacteria 7027
116 Ga0466719_175336 3300042606 Bacteria 6250
117 IMNBL1DRAFT_c0007827 3300000062 Bacteria 5546
118 Ga0466705_239968 3300042612 Bacteria 2656
119 Ga0466710_241070 3300042613 Bacteria 2796
120 Ga0466710_272501 3300042613 Bacteria 16412
121 Ga0466711_246769 3300042615 Bacteria 14917
122 Ga0466715_115534 3300042616 Bacteria 27264
123 Ga0466715_449728 3300042616 Bacteria 19735
124 Ga0466723_024450 3300042618 Bacteria 15240
125 Ga0466726_012664 3300042619 Bacteria 14117
126 Ga0466726_030060 3300042619 Bacteria 20392
127 Ga0466726_162837 3300042619 Bacteria 13744
128 Ga0466728_362743 3300042620 Bacteria 7089
129 Ga0466728_384672 3300042620 Bacteria 2886
130 Ga0466690_062044 3300042590 Bacteria 4269
131 Ga0466690_412796 3300042590 Bacteria 17631
132 Ga0466690_420451 3300042590 Bacteria 55352
133 Ga0466691_014851 3300042593 Bacteria 13862
134 Ga0466691_090120 3300042593 Bacteria 11302
135 Ga0466696_147532 3300042596 Bacteria 40988
136 Ga0466703_074575 3300042636 Bacteria 2439
137 Ga0466703_343602 3300042636 Bacteria 3598
138 Ga0466704_036280 3300042643 Bacteria 12387
139 Ga0466704_210346 3300042643 Bacteria 12652
140 Ga0466709_419096 3300042648 Bacteria 56162
141 Ga0466708_090546 3300042652 Bacteria 12205
142 Ga0466708_114657 3300042652 Bacteria 19666
143 Ga0466708_228583 3300042652 Bacteria 25073
144 Ga0466716_157882 3300042605 Bacteria 2772
145 Ga0466719_065640 3300042606 Bacteria 4129
146 Ga0466719_234023 3300042606 Bacteria 8613
147 Ga0466719_438760 3300042606 Bacteria 6175
148 Ga0466712_201694 3300042614 Bacteria 4188
149 Ga0466715_101945 3300042616 Bacteria 16309
150 Ga0466715_599373 3300042616 Bacteria 3974
151 Ga0466723_118562 3300042618 Bacteria 10951
152 Ga0466723_162040 3300042618 Unclassified 6798
153 Ga0466726_325045 3300042619 Bacteria 2312
154 Ga0466728_328721 3300042620 Bacteria 8795
155 Ga0466728_390032 3300042620 Bacteria 10036
156 Ga0466657_255862 3300042582 Bacteria 22428
157 Ga0466690_136608 3300042590 Bacteria 6831
158 Ga0466690_184741 3300042590 Bacteria 23964
159 Ga0466691_216335 3300042593 Bacteria 4632
160 Ga0466696_245085 3300042596 Bacteria 5197
161 Ga0466729_297621 3300042621 Bacteria 12032
162 Ga0466735_029393 3300042624 Bacteria 3601
163 Ga0466735_121279 3300042624 Bacteria 3275
164 Ga0466735_167486 3300042624 Bacteria 3324
165 Ga0466703_243709 3300042636 Bacteria 10168
166 Ga0466704_100895 3300042643 Bacteria 39526
167 Ga0466704_161427 3300042643 Bacteria 11789
168 Ga0466708_406084 3300042652 Bacteria 3534
169 Ga0466727_293137 3300042655 Bacteria 3754
170 Ga0466727_329309 3300042655 Unclassified 3204
171 Ga0466706_178083 3300042599 Bacteria 37293
172 Ga0466716_004670 3300042605 Bacteria 1947
173 Ga0466716_462142 3300042605 Bacteria 4132
174 Ga0466719_143659 3300042606 Bacteria 4357
175 Ga0466722_020690 3300042609 Bacteria 3061
176 Ga0466722_136436 3300042609 Bacteria 9717
177 Ga0466722_136584 3300042609 Bacteria 2029

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 405 478 0.94
PF01134 GIDA Glucose inhibited division protein A 265 297 0.92
PF13192 Thioredoxin_3 Thioredoxin domain 176 236 0.89
PF01946 Thi4 Thi4 family 259 295 0.86
PF12831 FAD_oxidored FAD dependent oxidoreductase 265 299 0.86
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 264 541 0.85
PF13738 Pyr_redox_3 Pyridine nucleotide-disulphide oxidoreductase 311 535 0.75

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF07992 GO:0016491 oxidoreductase activity MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.