Protein Family IF07999
Metagenome
Isolate
153
Members
37
Samples
150
Scaffolds
306.07
Avg Length
Representative Sequence
- ID
- 3300042618|Ga0466723_022071|Ga0466723_022071_423_1343
- Length
- 301 aa
- Sequence
- MKTIKLGKSNLAVPVIAVGCMRINGVDRKTAEGFVRTALELGANFFDHADCYGGGECESIFADVIGMNSAVREKILLQSKCGIVPGKMFDFSKEHILEAADGILKRLKTDYLDVLLLHRPDALVEPEEVAEAFDRLYSGGKVRNFGVSNQDPYLIRLLQRSVKQPIVVNQTNATLITQTMNMNMPDDMAIDRDNGTLNFCRLNSITIQPWSPFQYGFFQGTFIGNEKFQALNAKLDEIAGRYNVSAVTIALAWLLRHPAKFQPVTGTMNAARLGECVKAADITLSREEWYEIFLAAGHRLP
Sample Types
Isolate
2.0%
Metagenome
98.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
37.8%
Termitidae
29.7%
Unclassified
13.5%
Rhinotermitidae
10.8%
Termopsidae
5.4%
Hodotermitidae
2.7%
Taxonomy
Archaea
0
Bacteria
141
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 2 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 3 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 4 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 5 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 6 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 7 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 8 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 9 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 10 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 11 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 12 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 13 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 14 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 15 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 16 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 17 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 18 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 19 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 20 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 21 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 22 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 23 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 24 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 25 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 26 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 27 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 28 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 29 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 30 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 31 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 32 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 33 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 34 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 35 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 36 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 37 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_324575 | 3300042612 | Bacteria | 4389 |
| 2 | Ga0466716_229962 | 3300042605 | Bacteria | 1990 |
| 3 | Ga0466716_448243 | 3300042605 | Bacteria | 3699 |
| 4 | Ga0466719_006586 | 3300042606 | Bacteria | 18894 |
| 5 | Ga0466719_186642 | 3300042606 | Bacteria | 9586 |
| 6 | Ga0466690_073647 | 3300042590 | Bacteria | 3388 |
| 7 | Ga0466691_016743 | 3300042593 | Bacteria | 17225 |
| 8 | Ga0466696_162082 | 3300042596 | Bacteria | 1815 |
| 9 | JGI24698J34947_10003381 | 3300002449 | Bacteria | 8656 |
| 10 | Ga0466703_084075 | 3300042636 | Bacteria | 13882 |
| 11 | Ga0466703_125848 | 3300042636 | Bacteria | 18729 |
| 12 | Ga0466704_032109 | 3300042643 | Bacteria | 6477 |
| 13 | Ga0466709_247397 | 3300042648 | Bacteria | 5086 |
| 14 | Ga0466708_089089 | 3300042652 | Bacteria | 1614 |
| 15 | Ga0466725_383485 | 3300042654 | Bacteria | 1297 |
| 16 | Ga0466705_521421 | 3300042612 | Bacteria | 4637 |
| 17 | Ga0466712_293915 | 3300042614 | Bacteria | 1788 |
| 18 | Ga0466711_019132 | 3300042615 | Bacteria | 57265 |
| 19 | Ga0466711_241821 | 3300042615 | Bacteria | 4037 |
| 20 | Ga0466719_111516 | 3300042606 | Bacteria | 2405 |
| 21 | Ga0466696_470335 | 3300042596 | Bacteria | 3420 |
| 22 | Ga0466704_072559 | 3300042643 | Bacteria | 15814 |
| 23 | Ga0466704_124009 | 3300042643 | Bacteria | 8949 |
| 24 | Ga0466704_285386 | 3300042643 | Bacteria | 59541 |
| 25 | Ga0466704_323534 | 3300042643 | Bacteria | 49468 |
| 26 | Ga0466708_071721 | 3300042652 | Bacteria | 10128 |
| 27 | Ga0466727_087513 | 3300042655 | Bacteria | 3279 |
| 28 | Ga0466712_009972 | 3300042614 | Bacteria | 29783 |
| 29 | Ga0466712_313318 | 3300042614 | Bacteria | 28274 |
| 30 | Ga0466711_412466 | 3300042615 | Bacteria | 3296 |
| 31 | Ga0466715_032722 | 3300042616 | Bacteria | 3305 |
| 32 | Ga0466715_334084 | 3300042616 | Bacteria | 3788 |
| 33 | Ga0466723_047296 | 3300042618 | Bacteria | 5957 |
| 34 | Ga0466723_146142 | 3300042618 | Bacteria | 10143 |
| 35 | Ga0466728_052235 | 3300042620 | Bacteria | 1191 |
| 36 | Ga0466728_122629 | 3300042620 | Bacteria | 3672 |
| 37 | Ga0466705_260812 | 3300042612 | Bacteria | 6088 |
| 38 | Ga0466705_304977 | 3300042612 | Bacteria | 3344 |
| 39 | Ga0466705_330876 | 3300042612 | Bacteria | 2292 |
| 40 | Ga0466719_343379 | 3300042606 | Bacteria | 1422 |
| 41 | Ga0466722_121877 | 3300042609 | Bacteria | 5752 |
| 42 | Ga0466722_156581 | 3300042609 | Bacteria | 34892 |
| 43 | Ga0466722_157426 | 3300042609 | Bacteria | 2224 |
| 44 | Ga0466691_023750 | 3300042593 | Bacteria | 12435 |
| 45 | Ga0466694_249383 | 3300042594 | Bacteria | 11841 |
| 46 | JGI24698J34947_10027675 | 3300002449 | Bacteria | 3006 |
| 47 | Ga0466709_078006 | 3300042648 | Bacteria | 4246 |
| 48 | Ga0466709_122280 | 3300042648 | Bacteria | 12917 |
| 49 | Ga0466708_197029 | 3300042652 | Bacteria | 3814 |
| 50 | Ga0466708_200533 | 3300042652 | Bacteria | 1501 |
| 51 | Ga0466708_227435 | 3300042652 | Bacteria | 5422 |
| 52 | Ga0466708_305483 | 3300042652 | Bacteria | 13849 |
| 53 | Ga0466708_370958 | 3300042652 | Bacteria | 14480 |
| 54 | Ga0466727_009334 | 3300042655 | Bacteria | 1368 |
| 55 | Ga0466723_022071 | 3300042618 | Bacteria | 11072 |
| 56 | Ga0466705_005207 | 3300042612 | Unclassified | 4201 |
| 57 | Ga0466706_151133 | 3300042599 | Unclassified | 2527 |
| 58 | Ga0466714_135021 | 3300042603 | Bacteria | 1780 |
| 59 | Ga0466716_124156 | 3300042605 | Bacteria | 26855 |
| 60 | Ga0466719_431752 | 3300042606 | Bacteria | 3430 |
| 61 | Ga0466722_090765 | 3300042609 | Bacteria | 3802 |
| 62 | Ga0456237_0003685 | 3300041968 | Bacteria | 2470 |
| 63 | Ga0466690_212004 | 3300042590 | Bacteria | 5293 |
| 64 | Ga0466690_307960 | 3300042590 | Bacteria | 3944 |
| 65 | Ga0466692_178005 | 3300042591 | Bacteria | 1139 |
| 66 | Ga0466696_193763 | 3300042596 | Bacteria | 3360 |
| 67 | Ga0466699_149817 | 3300042597 | Bacteria | 8853 |
| 68 | Ga0466712_321397 | 3300042614 | Bacteria | 4820 |
| 69 | Ga0466711_233118 | 3300042615 | Bacteria | 21271 |
| 70 | Ga0466711_267812 | 3300042615 | Bacteria | 1299 |
| 71 | Ga0466715_236298 | 3300042616 | Bacteria | 9493 |
| 72 | Ga0466715_438711 | 3300042616 | Bacteria | 6406 |
| 73 | Ga0466723_064351 | 3300042618 | Unclassified | 1198 |
| 74 | Ga0466705_132803 | 3300042612 | Bacteria | 5288 |
| 75 | Ga0123354_10125238 | 3300010882 | Bacteria | 3287 |
| 76 | Ga0466706_193791 | 3300042599 | Bacteria | 1434 |
| 77 | Ga0466716_148013 | 3300042605 | Bacteria | 4393 |
| 78 | Ga0466716_267980 | 3300042605 | Bacteria | 6653 |
| 79 | Ga0466722_265086 | 3300042609 | Bacteria | 4872 |
| 80 | Ga0466690_243270 | 3300042590 | Bacteria | 4626 |
| 81 | Ga0466691_105156 | 3300042593 | Bacteria | 8838 |
| 82 | Ga0068305_10003249 | 3300005083 | Bacteria | 31499 |
| 83 | Ga0466703_196062 | 3300042636 | Bacteria | 7222 |
| 84 | Ga0466704_541085 | 3300042643 | Bacteria | 3703 |
| 85 | Ga0466704_577719 | 3300042643 | Bacteria | 4423 |
| 86 | Ga0466709_258034 | 3300042648 | Bacteria | 3269 |
| 87 | Ga0466709_297103 | 3300042648 | Unclassified | 7880 |
| 88 | Ga0466715_103206 | 3300042616 | Bacteria | 10008 |
| 89 | Ga0466715_156588 | 3300042616 | Bacteria | 6354 |
| 90 | Ga0466723_163569 | 3300042618 | Bacteria | 4667 |
| 91 | Ga0466728_455935 | 3300042620 | Bacteria | 6324 |
| 92 | Ga0466729_075160 | 3300042621 | Bacteria | 1890 |
| 93 | Ga0466705_045176 | 3300042612 | Bacteria | 16006 |
| 94 | Ga0466701_074618 | 3300042598 | Bacteria | 5099 |
| 95 | Ga0466719_388753 | 3300042606 | Bacteria | 3656 |
| 96 | Ga0466722_027895 | 3300042609 | Unclassified | 2111 |
| 97 | Ga0466722_066249 | 3300042609 | Bacteria | 12867 |
| 98 | Ga0466722_101107 | 3300042609 | Bacteria | 2499 |
| 99 | Ga0466691_040883 | 3300042593 | Bacteria | 13942 |
| 100 | Ga0466704_222530 | 3300042643 | Bacteria | 1284 |
| 101 | Ga0466708_237089 | 3300042652 | Bacteria | 14845 |
| 102 | Ga0466711_042142 | 3300042615 | Bacteria | 21683 |
| 103 | Ga0466715_321866 | 3300042616 | Bacteria | 9130 |
| 104 | Ga0466715_550328 | 3300042616 | Bacteria | 33510 |
| 105 | Ga0466726_442663 | 3300042619 | Bacteria | 9440 |
| 106 | Ga0466705_066531 | 3300042612 | Bacteria | 1570 |
| 107 | Ga0466714_141393 | 3300042603 | Bacteria | 21767 |
| 108 | Ga0466717_053764 | 3300042604 | Bacteria | 3459 |
| 109 | Ga0466716_163760 | 3300042605 | Unclassified | 1844 |
| 110 | Ga0466690_195676 | 3300042590 | Bacteria | 2644 |
| 111 | Ga0466691_143552 | 3300042593 | Bacteria | 3650 |
| 112 | Ga0466694_009163 | 3300042594 | Bacteria | 4409 |
| 113 | Ga0466696_011375 | 3300042596 | Bacteria | 20671 |
| 114 | JGI24698J34947_10000312 | 3300002449 | Bacteria | 21348 |
| 115 | JGI24698J34947_10003785 | 3300002449 | Unclassified | 8247 |
| 116 | JGI24702J35022_10004331 | 3300002462 | Bacteria | 8462 |
| 117 | Ga0466729_306904 | 3300042621 | Bacteria | 1153 |
| 118 | Ga0466703_034515 | 3300042636 | Bacteria | 1983 |
| 119 | Ga0466703_243445 | 3300042636 | Bacteria | 22412 |
| 120 | Ga0466704_043589 | 3300042643 | Bacteria | 9696 |
| 121 | Ga0466704_382132 | 3300042643 | Bacteria | 2977 |
| 122 | Ga0466709_285069 | 3300042648 | Unclassified | 70923 |
| 123 | Ga0466727_184101 | 3300042655 | Bacteria | 3146 |
| 124 | Ga0466723_002580 | 3300042618 | Bacteria | 10932 |
| 125 | Ga0466723_011291 | 3300042618 | Bacteria | 4274 |
| 126 | Ga0466723_044534 | 3300042618 | Bacteria | 19776 |
| 127 | Ga0466723_232320 | 3300042618 | Bacteria | 11592 |
| 128 | Ga0466705_027622 | 3300042612 | Bacteria | 4409 |
| 129 | Ga0466705_226218 | 3300042612 | Bacteria | 9476 |
| 130 | Ga0466733_143163 | 3300042659 | Bacteria | 1710 |
| 131 | Ga0466713_080487 | 3300042602 | Unclassified | 37112 |
| 132 | Ga0466719_217151 | 3300042606 | Bacteria | 26510 |
| 133 | Ga0466690_141501 | 3300042590 | Bacteria | 13632 |
| 134 | Ga0466692_026415 | 3300042591 | Bacteria | 14795 |
| 135 | Ga0466692_080566 | 3300042591 | Bacteria | 4065 |
| 136 | Ga0466691_027630 | 3300042593 | Bacteria | 8459 |
| 137 | JGI24698J34947_10000754 | 3300002449 | Unclassified | 15970 |
| 138 | JGI24698J34947_10000845 | 3300002449 | Bacteria | 15387 |
| 139 | Ga0466703_124796 | 3300042636 | Bacteria | 2936 |
| 140 | Ga0466704_015275 | 3300042643 | Bacteria | 4125 |
| 141 | Ga0466704_264832 | 3300042643 | Bacteria | 17760 |
| 142 | Ga0466704_331660 | 3300042643 | Unclassified | 9047 |
| 143 | Ga0466727_004271 | 3300042655 | Bacteria | 2738 |
| 144 | Ga0466711_004871 | 3300042615 | Bacteria | 6189 |
| 145 | Ga0466711_155095 | 3300042615 | Bacteria | 2807 |
| 146 | Ga0466715_033957 | 3300042616 | Bacteria | 17759 |
| 147 | Ga0466715_111095 | 3300042616 | Bacteria | 92411 |
| 148 | Ga0466715_183733 | 3300042616 | Bacteria | 42572 |
| 149 | Ga0466723_299185 | 3300042618 | Bacteria | 1670 |
| 150 | Ga0466728_356908 | 3300042620 | Unclassified | 5743 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00248 | Aldo_ket_red | Aldo/keto reductase family | 16 | 292 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.