Protein Family IF07976

Metagenome Metatranscriptome Isolate
142 Members
58 Samples
116 Scaffolds
299.68 Avg Length

🧬 Representative Sequence

ID
3300042617|Ga0466718_170726|Ga0466718_170726_1276_2328
Length
350 aa
Sequence
MSISAFPGFSSILFFNGGSMGKSKFKDIFTPVIEKLQNKISQLMGSSKSRDISRRNSPLFFLFLFPAVFAFCMVIVIPFIMGIYYSFTDWNAITGTKVEWVGFKNYFAVKSDITFLHSFLVTVAYAVMNIIVLNVCSFFMALLVTSKLKFKGIYRAGFFLPNLIGGLILGYIWQFIFNNAIPSLGSAIGFTWLNEHLFLADRYLALLAIVIVGTWQYAGYIMMIYVAAIQGIPDSLLEAAEIDGANYFQKLKAITFPLVAPAFTVSMFLTLINSFKQFDVNYSLTAGGPSGMFMGKALMTNEFLALNIYQTAFAYRRLAEGQAKAIIFFIVIAVISMIQVRANKKREIEM

📊 Sample Types

Isolate 18.3%
Metagenome 80.3%
MAG 0.0%
Metatranscriptome 1.4%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 51.0%
Unclassified 27.5%
Scarabaeidae 5.9%
Armadillidiidae 5.9%
Blattidae 3.9%
Ceratopogonidae 2.0%
Euphausiidae 2.0%
Apidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 128
Eukaryota 0
Viruses 0
Unclassified 14

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
2 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
3 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
4 8007215774 Enterococcus sp. BWR-S5 Isolate Scarabaeidae
5 2590828840 Clostridium sp. 2 Isolate Termitidae
6 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
7 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
8 2781125639 Treponema sp. Co191P1bin44 Isolate Unclassified
9 2914375287 Culicoidibacter larvae CS-1 Isolate Ceratopogonidae
10 2820492969 Unclassified Firmicutes Lab288P1bin6 Isolate Unclassified
11 2820518089 Unclassified Firmicutes Lab288P1bin27 Isolate Unclassified
12 2820661146 Unclassified Firmicutes Co191P3bin61 Isolate Unclassified
13 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
14 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
15 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
16 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
17 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
18 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
19 3300021235 Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA Metatranscriptome
20 2940261461 Enterococcus sp. PFB1-1 Isolate Blattidae
21 8002519755 Planococcus sp. MSAK28401 Isolate Euphausiidae
22 2576861701 Paenibacillus sp. JCM 10914 Isolate Termitidae
23 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
24 2820690275 Unclassified Firmicutes Co191P1bin72 Isolate Unclassified
25 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
26 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
27 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
28 8114544644 Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 Isolate
29 2940218408 Enterococcus sp. PF1-24 Isolate Blattidae
30 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
31 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
32 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
33 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
34 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
35 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
36 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
37 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
38 8007211731 Enterococcus larvae BWM-S5 Isolate Scarabaeidae
39 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
40 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
41 2820303403 Unclassified Firmicutes Th196P1bin2 Isolate Unclassified
42 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
43 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
44 3300022820 Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA Metatranscriptome Termitidae
45 8007220153 Enterococcus sp. BWB1-3 Isolate Scarabaeidae
46 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
47 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
48 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
49 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
50 2971438493 Paenibacillus apiarius NRRL B-23460 Isolate Apidae
51 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
52 2820647881 Unclassified Firmicutes Cu122P5bin16 Isolate Unclassified
53 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
54 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
55 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
56 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
57 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
58 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0072940_1026384 3300005200 Bacteria 2695
2 Ga0072941_1017710 3300005201 Bacteria 11766
3 Ga0466700_026514 3300042600 Bacteria 2089
4 Ga0466720_008043 3300042607 Bacteria 17616
5 Ga0466720_074085 3300042607 Bacteria 14783
6 Ga0160452_100171 3300012834 Bacteria 73091
7 Ga0466694_283213 3300042594 Bacteria 11661
8 Ga0123355_10042806 3300009826 Bacteria 7370
9 Ga0123356_10016985 3300010049 Bacteria 6931
10 Ga0123356_10387579 3300010049 Unclassified 1532
11 Ga0466702_091610 3300042635 Bacteria 5438
12 Ga0466712_111064 3300042614 Unclassified 1025
13 Ga0466712_152210 3300042614 Bacteria 4402
14 AustNasuHG_c1000566 3300000089 Bacteria 13048
15 AustNasuHG_c1016322 3300000089 Bacteria 2486
16 JGI24695J34938_10002034 3300002450 Bacteria 16007
17 JGI24695J34938_10002832 3300002450 Bacteria 12672
18 JGI24702J35022_10017018 3300002462 Bacteria 3979
19 Ga0466700_030475 3300042600 Bacteria 1270
20 Ga0160467_100446 3300012829 Bacteria 40949
21 Ga0466695_327930 3300042595 Bacteria 1942
22 Ga0123357_10274857 3300009784 Unclassified 1752
23 Ga0123355_10386346 3300009826 Bacteria 1819
24 Ga0123356_10004318 3300010049 Bacteria 14703
25 Ga0123356_10008972 3300010049 Bacteria 9897
26 JGI24698J34947_10010919 3300002449 Bacteria 4983
27 Ga0072940_1079342 3300005200 Bacteria 1730
28 Ga0072941_1040822 3300005201 Bacteria 3779
29 Ga0466720_099513 3300042607 Bacteria 11147
30 Ga0415639_009704 3300038395 Bacteria 17473
31 Ga0123355_10049523 3300009826 Bacteria 6831
32 Ga0123356_10001395 3300010049 Bacteria 26785
33 Ga0123356_10286957 3300010049 Bacteria 1744
34 Ga0123356_10688854 3300010049 Bacteria 1191
35 Ga0123353_10726701 3300010167 Unclassified 1387
36 JGI24695J34938_10068214 3300002450 Bacteria 1494
37 Ga0466720_011638 3300042607 Bacteria 12539
38 Ga0466720_125687 3300042607 Unclassified 1164
39 Ga0466720_216796 3300042607 Bacteria 13997
40 Ga0160443_100292 3300012848 Bacteria 47760
41 Ga0466694_112593 3300042594 Bacteria 3651
42 Ga0123356_10001270 3300010049 Bacteria 27893
43 Ga0123356_10087891 3300010049 Bacteria 2954
44 Ga0123356_10602521 3300010049 Bacteria 1263
45 Ga0123353_10110464 3300010167 Unclassified 4430
46 Ga0160464_100361 3300012805 Bacteria 37249
47 Ga0466712_228106 3300042614 Bacteria 3622
48 Ga0466718_166880 3300042617 Bacteria 3126
49 Ga0466718_170726 3300042617 Bacteria 3728
50 Ga0466732_143228 3300042656 Unclassified 3978
51 JGI24698J34947_10015341 3300002449 Unclassified 4171
52 Ga0072941_1029598 3300005201 Bacteria 3835
53 Ga0223674_1004149 3300021235 Bacteria 1962
54 Ga0264413_110098 3300024493 Bacteria 8298
55 Ga0264413_118018 3300024493 Unclassified 1704
56 Ga0466693_373023 3300042592 Bacteria 1763
57 Ga0466699_084154 3300042597 Unclassified 1157
58 Ga0123355_10824857 3300009826 Bacteria 1028
59 Ga0466712_029471 3300042614 Bacteria 7409
60 Ga0466712_312751 3300042614 Bacteria 9102
61 AustNasuHG_c1013577 3300000089 Bacteria 2790
62 JGI24698J34947_10001681 3300002449 Bacteria 11815
63 JGI24698J34947_10012894 3300002449 Bacteria 4567
64 JGI24695J34938_10015587 3300002450 Bacteria 3894
65 Ga0072941_1021130 3300005201 Bacteria 5820
66 Ga0074263_113055 3300005485 Bacteria 4508
67 Ga0466700_224658 3300042600 Bacteria 11492
68 Ga0466720_060886 3300042607 Bacteria 72880
69 Ga0466720_063650 3300042607 Bacteria 12476
70 Ga0466720_099809 3300042607 Bacteria 1616
71 Ga0466720_116353 3300042607 Unclassified 2775
72 Ga0466720_125978 3300042607 Bacteria 8076
73 Ga0160456_105270 3300012820 Bacteria 1590
74 Ga0160452_100331 3300012834 Bacteria 41373
75 Ga0415639_027758 3300038395 Bacteria 5126
76 Ga0415639_066436 3300038395 Bacteria 3720
77 Ga0415639_140667 3300038395 Bacteria 4528
78 Ga0466694_026216 3300042594 Bacteria 44731
79 Ga0466695_082957 3300042595 Bacteria 1598
80 Ga0466699_029120 3300042597 Bacteria 5208
81 Ga0466699_127163 3300042597 Bacteria 26841
82 Ga0160454_100087 3300012798 Bacteria 122789
83 Ga0466731_393002 3300042622 Bacteria 4635
84 Ga0466731_416318 3300042622 Bacteria 7678
85 Ga0466712_107627 3300042614 Bacteria 10591
86 Ga0466712_306684 3300042614 Bacteria 7870
87 Ga0466718_132016 3300042617 Bacteria 12388
88 Ga0466732_247289 3300042656 Bacteria 3391
89 JGI24698J34947_10005022 3300002449 Bacteria 7248
90 JGI24695J34938_10001192 3300002450 Bacteria 23047
91 JGI24695J34938_10016422 3300002450 Bacteria 3763
92 JGI24702J35022_10024092 3300002462 Bacteria 3289
93 Ga0072941_1014918 3300005201 Bacteria 22266
94 Ga0466721_404092 3300042608 Bacteria 7268
95 Ga0264413_118019 3300024493 Bacteria 1912
96 Ga0264413_139582 3300024493 Bacteria 7590
97 Ga0415639_019119 3300038395 Bacteria 10539
98 Ga0123355_10070033 3300009826 Bacteria 5635
99 Ga0123355_10270032 3300009826 Bacteria 2365
100 JGI24698J34947_10001927 3300002449 Bacteria 11053
101 JGI24698J34947_10013232 3300002449 Unclassified 4508
102 JGI24695J34938_10002157 3300002450 Bacteria 15356
103 JGI24695J34938_10012207 3300002450 Bacteria 4570
104 Ga0466700_050616 3300042600 Bacteria 1483
105 Ga0466720_068756 3300042607 Bacteria 21438
106 Ga0466720_071656 3300042607 Bacteria 13075
107 Ga0255809_1041624 3300022820 Bacteria 1722
108 Ga0415639_095757 3300038395 Bacteria 4635
109 Ga0466693_150047 3300042592 Bacteria 9059
110 Ga0466695_194386 3300042595 Bacteria 11694
111 Ga0466699_022696 3300042597 Bacteria 1780
112 Ga0123355_10001222 3300009826 Bacteria 35810
113 Ga0123356_10017883 3300010049 Bacteria 6734
114 Ga0123356_10356988 3300010049 Bacteria 1587
115 Ga0123356_10527570 3300010049 Unclassified 1339
116 Ga0123356_11002636 3300010049 Unclassified 1005

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component 149 342 0.86

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.