Protein Family IF07958
Metagenome
Isolate
156
Members
52
Samples
146
Scaffolds
268.1
Avg Length
Representative Sequence
- ID
- 3300042617|Ga0466718_134696|Ga0466718_134696_1792_2772
- Length
- 319 aa
- Sequence
- MKFTVLTLFPEITDAYFASSIMARALDRGIISYQAVNIRDFATDKHKTCDDAPYGGGPGMLMLAEPLSRALKMVSDTRRANLNIPQELTQGNKDTKDIKPRNNSRIFKILSFFLCGLRVFVRGIGTMVPDTFFGGSGGPQGRSENSFGRMTGNRPPHIIYLTPSGRPFTQRRAEELAAMEELVLVCGRYEGIDQRVIDAYVDEELSVGDYVLSSGEVAALAVIDTVYRLVDRVITPESLEEESFSGGLLEYPQYTRPETFDTMKVPEVLLSGHHENIRRWRLKKRIEKTRAFRPELLEQGLQMGLFDAETVKLIEESKG
Sample Types
Isolate
6.4%
Metagenome
93.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.3%
Kalotermitidae
27.5%
Unclassified
23.5%
Rhinotermitidae
5.9%
Termopsidae
3.9%
Blaberidae
2.0%
Taxonomy
Archaea
0
Bacteria
152
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 2 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 3 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 4 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 5 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 6 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 7 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 8 | 2781125685 | Treponema sp. Lab288P1bin13 | Isolate | Unclassified |
| 9 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 10 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 11 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 12 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 13 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 14 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 15 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 16 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 17 | 2781125653 | Treponema sp. Emb289P1bin107 | Isolate | Unclassified |
| 18 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 19 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 20 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 21 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 22 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 23 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 24 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 25 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 26 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 27 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 28 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 29 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 30 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 31 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 32 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 33 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 34 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 35 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 36 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 37 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 38 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 39 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 40 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 41 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 42 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 43 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 44 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 45 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 46 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 47 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 48 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 49 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 50 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 51 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 52 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_367955 | 3300042656 | Bacteria | 4685 |
| 2 | Ga0466733_056222 | 3300042659 | Bacteria | 1239 |
| 3 | Ga0466712_216793 | 3300042614 | Bacteria | 5382 |
| 4 | Ga0466715_056288 | 3300042616 | Bacteria | 15745 |
| 5 | Ga0466715_390903 | 3300042616 | Bacteria | 4042 |
| 6 | Ga0466715_586931 | 3300042616 | Bacteria | 2193 |
| 7 | Ga0466726_155168 | 3300042619 | Bacteria | 1068 |
| 8 | Ga0466728_215685 | 3300042620 | Unclassified | 3208 |
| 9 | Ga0123354_10012335 | 3300010882 | Bacteria | 13247 |
| 10 | Ga0466731_014658 | 3300042622 | Bacteria | 2824 |
| 11 | Ga0466703_334573 | 3300042636 | Bacteria | 22610 |
| 12 | Ga0466704_194953 | 3300042643 | Bacteria | 8389 |
| 13 | Ga0466716_169800 | 3300042605 | Bacteria | 1244 |
| 14 | Ga0466716_292733 | 3300042605 | Bacteria | 1747 |
| 15 | Ga0466719_208925 | 3300042606 | Bacteria | 3445 |
| 16 | Ga0466698_276258 | 3300042610 | Bacteria | 1440 |
| 17 | JGI24695J34938_10007595 | 3300002450 | Bacteria | 6313 |
| 18 | Ga0072940_1061474 | 3300005200 | Bacteria | 1133 |
| 19 | Ga0466690_118372 | 3300042590 | Bacteria | 1537 |
| 20 | Ga0466692_202348 | 3300042591 | Bacteria | 11392 |
| 21 | Ga0466691_025884 | 3300042593 | Bacteria | 3779 |
| 22 | Ga0466705_265375 | 3300042612 | Bacteria | 10368 |
| 23 | Ga0466705_349794 | 3300042612 | Bacteria | 18509 |
| 24 | Ga0466733_153474 | 3300042659 | Bacteria | 1937 |
| 25 | Ga0466715_252755 | 3300042616 | Bacteria | 4757 |
| 26 | Ga0123355_10024420 | 3300009826 | Bacteria | 9717 |
| 27 | Ga0123355_10079961 | 3300009826 | Bacteria | 5220 |
| 28 | Ga0123353_10292933 | 3300010167 | Bacteria | 2490 |
| 29 | Ga0466703_204295 | 3300042636 | Bacteria | 43577 |
| 30 | Ga0466704_455778 | 3300042643 | Bacteria | 13362 |
| 31 | Ga0466708_027666 | 3300042652 | Bacteria | 2687 |
| 32 | Ga0466720_189522 | 3300042607 | Bacteria | 75127 |
| 33 | Ga0466722_048732 | 3300042609 | Bacteria | 9393 |
| 34 | Ga0466722_130573 | 3300042609 | Bacteria | 3684 |
| 35 | Ga0466722_228701 | 3300042609 | Bacteria | 35562 |
| 36 | JGI24695J34938_10000339 | 3300002450 | Bacteria | 46161 |
| 37 | Ga0466694_339535 | 3300042594 | Bacteria | 2291 |
| 38 | Ga0466695_363565 | 3300042595 | Bacteria | 3807 |
| 39 | Ga0466711_155221 | 3300042615 | Bacteria | 8949 |
| 40 | Ga0466718_134696 | 3300042617 | Bacteria | 11325 |
| 41 | Ga0466726_025403 | 3300042619 | Bacteria | 17152 |
| 42 | Ga0466713_015266 | 3300042602 | Unclassified | 1992 |
| 43 | Ga0466720_028735 | 3300042607 | Bacteria | 9303 |
| 44 | Ga0466720_147532 | 3300042607 | Bacteria | 19881 |
| 45 | Ga0466722_240597 | 3300042609 | Bacteria | 21211 |
| 46 | JGI24702J35022_10046191 | 3300002462 | Bacteria | 2320 |
| 47 | Ga0466690_378934 | 3300042590 | Bacteria | 1572 |
| 48 | Ga0466692_109634 | 3300042591 | Bacteria | 5639 |
| 49 | Ga0466692_114907 | 3300042591 | Bacteria | 7244 |
| 50 | Ga0466691_028650 | 3300042593 | Bacteria | 11312 |
| 51 | Ga0466694_006758 | 3300042594 | Bacteria | 4858 |
| 52 | Ga0466696_349610 | 3300042596 | Bacteria | 15799 |
| 53 | Ga0466705_269143 | 3300042612 | Bacteria | 16758 |
| 54 | Ga0466711_094388 | 3300042615 | Bacteria | 15197 |
| 55 | Ga0466718_098206 | 3300042617 | Unclassified | 1637 |
| 56 | Ga0123356_10098723 | 3300010049 | Bacteria | 2797 |
| 57 | Ga0466703_211797 | 3300042636 | Bacteria | 15429 |
| 58 | Ga0466703_357100 | 3300042636 | Bacteria | 5452 |
| 59 | Ga0466709_187506 | 3300042648 | Bacteria | 17887 |
| 60 | Ga0466708_121466 | 3300042652 | Bacteria | 3595 |
| 61 | Ga0466708_194789 | 3300042652 | Bacteria | 2036 |
| 62 | Ga0466727_215208 | 3300042655 | Bacteria | 5131 |
| 63 | Ga0466719_104467 | 3300042606 | Bacteria | 52022 |
| 64 | Ga0466719_250291 | 3300042606 | Bacteria | 8427 |
| 65 | Ga0466719_328708 | 3300042606 | Bacteria | 47326 |
| 66 | Ga0466698_126779 | 3300042610 | Bacteria | 3014 |
| 67 | Ga0466698_447223 | 3300042610 | Bacteria | 1714 |
| 68 | JGI24698J34947_10059384 | 3300002449 | Bacteria | 1891 |
| 69 | JGI24695J34938_10020584 | 3300002450 | Bacteria | 3243 |
| 70 | Ga0466690_194453 | 3300042590 | Bacteria | 24666 |
| 71 | Ga0466692_014463 | 3300042591 | Bacteria | 4055 |
| 72 | Ga0466691_095128 | 3300042593 | Bacteria | 3716 |
| 73 | Ga0466691_147418 | 3300042593 | Bacteria | 5553 |
| 74 | Ga0466694_043116 | 3300042594 | Bacteria | 6011 |
| 75 | Ga0466696_054381 | 3300042596 | Bacteria | 22881 |
| 76 | Ga0466696_191503 | 3300042596 | Bacteria | 28288 |
| 77 | Ga0466705_366885 | 3300042612 | Bacteria | 6571 |
| 78 | Ga0466732_309389 | 3300042656 | Bacteria | 2220 |
| 79 | Ga0466718_161492 | 3300042617 | Bacteria | 1689 |
| 80 | Ga0466726_237023 | 3300042619 | Bacteria | 2375 |
| 81 | Ga0466728_230610 | 3300042620 | Bacteria | 9048 |
| 82 | Ga0123355_10277956 | 3300009826 | Bacteria | 2316 |
| 83 | Ga0466703_230662 | 3300042636 | Bacteria | 11374 |
| 84 | Ga0466703_258510 | 3300042636 | Bacteria | 9817 |
| 85 | Ga0466704_434098 | 3300042643 | Bacteria | 82573 |
| 86 | Ga0466709_124415 | 3300042648 | Bacteria | 2378 |
| 87 | Ga0466708_170056 | 3300042652 | Bacteria | 23047 |
| 88 | Ga0466727_169415 | 3300042655 | Bacteria | 1108 |
| 89 | Ga0466707_009686 | 3300042601 | Bacteria | 2139 |
| 90 | Ga0466719_266020 | 3300042606 | Bacteria | 4681 |
| 91 | Ga0466722_040736 | 3300042609 | Bacteria | 50466 |
| 92 | Ga0466690_129983 | 3300042590 | Bacteria | 1453 |
| 93 | Ga0466699_150645 | 3300042597 | Bacteria | 8945 |
| 94 | Ga0466705_092551 | 3300042612 | Bacteria | 26948 |
| 95 | Ga0466711_016099 | 3300042615 | Bacteria | 25416 |
| 96 | Ga0466711_075671 | 3300042615 | Bacteria | 1699 |
| 97 | Ga0466715_504076 | 3300042616 | Bacteria | 8644 |
| 98 | Ga0466726_479224 | 3300042619 | Bacteria | 1526 |
| 99 | Ga0466728_141698 | 3300042620 | Bacteria | 7912 |
| 100 | Ga0123355_10456600 | 3300009826 | Bacteria | 1606 |
| 101 | Ga0466703_037051 | 3300042636 | Bacteria | 10749 |
| 102 | Ga0466704_018765 | 3300042643 | Bacteria | 3416 |
| 103 | Ga0466704_361875 | 3300042643 | Bacteria | 21493 |
| 104 | Ga0466708_019498 | 3300042652 | Bacteria | 5414 |
| 105 | Ga0466708_182639 | 3300042652 | Bacteria | 3633 |
| 106 | Ga0466719_060127 | 3300042606 | Bacteria | 2357 |
| 107 | Ga0466719_386560 | 3300042606 | Bacteria | 6389 |
| 108 | Ga0466720_105539 | 3300042607 | Bacteria | 11313 |
| 109 | JGI24695J34938_10023864 | 3300002450 | Bacteria | 2943 |
| 110 | Ga0456237_0000265 | 3300041968 | Bacteria | 7711 |
| 111 | Ga0466692_058837 | 3300042591 | Bacteria | 8087 |
| 112 | Ga0466727_352287 | 3300042655 | Bacteria | 1662 |
| 113 | Ga0466715_563315 | 3300042616 | Bacteria | 7994 |
| 114 | Ga0466718_024818 | 3300042617 | Bacteria | 4818 |
| 115 | Ga0466723_146098 | 3300042618 | Bacteria | 1813 |
| 116 | Ga0466726_235310 | 3300042619 | Bacteria | 8752 |
| 117 | Ga0466709_060873 | 3300042648 | Bacteria | 7283 |
| 118 | Ga0466709_095971 | 3300042648 | Bacteria | 7971 |
| 119 | Ga0466708_250415 | 3300042652 | Bacteria | 26600 |
| 120 | Ga0466708_442925 | 3300042652 | Bacteria | 1572 |
| 121 | Ga0466719_417794 | 3300042606 | Bacteria | 1397 |
| 122 | Ga0466719_517648 | 3300042606 | Bacteria | 2587 |
| 123 | JGI24695J34938_10000479 | 3300002450 | Bacteria | 38811 |
| 124 | Ga0068305_10012140 | 3300005083 | Bacteria | 3329 |
| 125 | Ga0466691_198028 | 3300042593 | Bacteria | 1794 |
| 126 | Ga0466696_503227 | 3300042596 | Bacteria | 3225 |
| 127 | Ga0466699_031561 | 3300042597 | Bacteria | 10277 |
| 128 | Ga0466699_301620 | 3300042597 | Bacteria | 2029 |
| 129 | Ga0466732_345866 | 3300042656 | Bacteria | 1943 |
| 130 | Ga0466712_147106 | 3300042614 | Unclassified | 3441 |
| 131 | Ga0466715_201282 | 3300042616 | Bacteria | 5426 |
| 132 | Ga0466715_504132 | 3300042616 | Bacteria | 1564 |
| 133 | Ga0466718_110428 | 3300042617 | Bacteria | 20802 |
| 134 | Ga0466718_116121 | 3300042617 | Bacteria | 2364 |
| 135 | Ga0466723_227422 | 3300042618 | Bacteria | 4026 |
| 136 | Ga0466726_370357 | 3300042619 | Bacteria | 4127 |
| 137 | Ga0466704_146694 | 3300042643 | Bacteria | 25254 |
| 138 | Ga0466704_575908 | 3300042643 | Bacteria | 4696 |
| 139 | Ga0466709_047041 | 3300042648 | Bacteria | 11623 |
| 140 | Ga0466708_214374 | 3300042652 | Bacteria | 4471 |
| 141 | Ga0466716_360237 | 3300042605 | Bacteria | 8659 |
| 142 | Ga0466698_482646 | 3300042610 | Bacteria | 1447 |
| 143 | AustNasuHG_c1000567 | 3300000089 | Bacteria | 13048 |
| 144 | JGI24702J35022_10041238 | 3300002462 | Bacteria | 2460 |
| 145 | Ga0068305_10268906 | 3300005083 | Bacteria | 27738 |
| 146 | Ga0264413_102353 | 3300024493 | Bacteria | 21492 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01746 | tRNA_m1G_MT | tRNA (Guanine-1)-methyltransferase | 127 | 294 | 0.96 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.