Protein Family IF07952
Metagenome
Isolate
149
Members
39
Samples
141
Scaffolds
206.83
Avg Length
Representative Sequence
- ID
- 3300042617|Ga0466718_128768|Ga0466718_128768_1372_1992
- Length
- 206 aa
- Sequence
- MIYGYIRVSTDRQNTENQKFEIRNFAKQNNMIINEWIEEKVSSTQDLQKRKLGKLIGRAKEGDLIIASELSRLGRNLLQVMGMLNHLMNTGVRVWTIKDGYKLGDDISSKVLAFAFGLSAEIERKLISERTKEALARIKADGKALGRPAGRRNNKSKLANRASYVRRLLSLGYSQAEAARRLGVHRATLAEFLKATGSKNPLAKPV
Sample Types
Isolate
4.7%
Metagenome
95.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
56.8%
Kalotermitidae
24.3%
Unclassified
16.2%
Termopsidae
2.7%
Taxonomy
Archaea
1
Bacteria
125
Eukaryota
0
Viruses
0
Unclassified
23
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 2 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 3 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 4 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 5 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 6 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 7 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 8 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 9 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 10 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 11 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 12 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 13 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 14 | 2228664003 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA | Metagenome | Termitidae |
| 15 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 16 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 17 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 18 | 2820021908 | Unclassified Spirochaetes Lab288P4bin6 | Isolate | Unclassified |
| 19 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 20 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 21 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 22 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 23 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 24 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 25 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 26 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 27 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 28 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 29 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 30 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 31 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 32 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 33 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 34 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 35 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 36 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 37 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 38 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 39 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_195003 | 3300042656 | Bacteria | 1521 |
| 2 | Ga0123356_10000046 | 3300010049 | Bacteria | 130593 |
| 3 | Ga0466712_072806 | 3300042614 | Bacteria | 22773 |
| 4 | Ga0466712_313091 | 3300042614 | Unclassified | 2202 |
| 5 | Ga0466718_010607 | 3300042617 | Unclassified | 1603 |
| 6 | Ga0264413_101460 | 3300024493 | Bacteria | 4837 |
| 7 | Ga0466699_059724 | 3300042597 | Bacteria | 4377 |
| 8 | AustNasuHG_c1025685 | 3300000089 | Bacteria | 1846 |
| 9 | JGI24695J34938_10002316 | 3300002450 | Bacteria | 14658 |
| 10 | JGI24695J34938_10098368 | 3300002450 | Bacteria | 1196 |
| 11 | JGI24695J34938_10120235 | 3300002450 | Bacteria | 1069 |
| 12 | JGI24695J34938_10200045 | 3300002450 | Bacteria | 832 |
| 13 | Ga0072941_1156062 | 3300005201 | Bacteria | 1127 |
| 14 | Ga0072941_1179511 | 3300005201 | Bacteria | 1700 |
| 15 | Ga0466731_047145 | 3300042622 | Bacteria | 1515 |
| 16 | Ga0466720_028989 | 3300042607 | Bacteria | 6405 |
| 17 | Ga0466720_115899 | 3300042607 | Unclassified | 9182 |
| 18 | Ga0466705_136446 | 3300042612 | Bacteria | 1137 |
| 19 | Ga0123353_10187346 | 3300010167 | Bacteria | 3270 |
| 20 | Ga0466712_162998 | 3300042614 | Bacteria | 34799 |
| 21 | Ga0466718_076187 | 3300042617 | Bacteria | 20059 |
| 22 | Ga0466723_148130 | 3300042618 | Bacteria | 1457 |
| 23 | Ga0466691_127696 | 3300042593 | Bacteria | 8088 |
| 24 | Ga0466691_131254 | 3300042593 | Bacteria | 1105 |
| 25 | Ga0466695_170334 | 3300042595 | Bacteria | 1243 |
| 26 | Ga0466699_391416 | 3300042597 | Bacteria | 1202 |
| 27 | AustNasuHG_c1004955 | 3300000089 | Bacteria | 4763 |
| 28 | AustNasuHG_c1013204 | 3300000089 | Unclassified | 2838 |
| 29 | AustNasuHG_c1014153 | 3300000089 | Unclassified | 2720 |
| 30 | JGI24695J34938_10000038 | 3300002450 | Bacteria | 98134 |
| 31 | JGI24695J34938_10000503 | 3300002450 | Bacteria | 37923 |
| 32 | Ga0072941_1164509 | 3300005201 | Unclassified | 4415 |
| 33 | Ga0074263_103451 | 3300005485 | Bacteria | 3057 |
| 34 | Ga0466703_236144 | 3300042636 | Bacteria | 1695 |
| 35 | Ga0466720_043961 | 3300042607 | Bacteria | 6712 |
| 36 | Ga0466720_058945 | 3300042607 | Bacteria | 9863 |
| 37 | Ga0466732_190166 | 3300042656 | Bacteria | 4012 |
| 38 | Ga0466712_064926 | 3300042614 | Bacteria | 1074 |
| 39 | Ga0466712_168090 | 3300042614 | Bacteria | 7749 |
| 40 | Ga0466718_032980 | 3300042617 | Unclassified | 2130 |
| 41 | Ga0466718_061591 | 3300042617 | Bacteria | 6902 |
| 42 | Ga0466718_070176 | 3300042617 | Bacteria | 11809 |
| 43 | Ga0466718_074974 | 3300042617 | Bacteria | 1026 |
| 44 | Ga0466718_075199 | 3300042617 | Bacteria | 3481 |
| 45 | Ga0466718_155802 | 3300042617 | Unclassified | 2748 |
| 46 | Ga0264413_106151 | 3300024493 | Unclassified | 11638 |
| 47 | Ga0264413_127454 | 3300024493 | Bacteria | 4855 |
| 48 | Ga0466691_111850 | 3300042593 | Bacteria | 1780 |
| 49 | AustNasuHG_c1003889 | 3300000089 | Bacteria | 5382 |
| 50 | AustNasuHG_c1029055 | 3300000089 | Unclassified | 1632 |
| 51 | AustNasuHG_c1043163 | 3300000089 | Bacteria | 1062 |
| 52 | JGI24698J34947_10008908 | 3300002449 | Bacteria | 5508 |
| 53 | JGI24698J34947_10139730 | 3300002449 | Bacteria | 1022 |
| 54 | JGI24695J34938_10010181 | 3300002450 | Bacteria | 5176 |
| 55 | Ga0072941_1013455 | 3300005201 | Bacteria | 31411 |
| 56 | Ga0072941_1041340 | 3300005201 | Bacteria | 6722 |
| 57 | Ga0466704_139675 | 3300042643 | Bacteria | 13760 |
| 58 | Ga0466720_005370 | 3300042607 | Bacteria | 6889 |
| 59 | Ga0466732_107458 | 3300042656 | Unclassified | 1287 |
| 60 | Ga0466732_190531 | 3300042656 | Bacteria | 5040 |
| 61 | Ga0466712_096001 | 3300042614 | Bacteria | 4443 |
| 62 | Ga0466712_172094 | 3300042614 | Bacteria | 11015 |
| 63 | Ga0466712_203591 | 3300042614 | Bacteria | 33442 |
| 64 | Ga0466715_335155 | 3300042616 | Bacteria | 10616 |
| 65 | Ga0466718_022948 | 3300042617 | Bacteria | 5861 |
| 66 | Ga0466718_128768 | 3300042617 | Bacteria | 4054 |
| 67 | Ga0466694_004233 | 3300042594 | Bacteria | 13141 |
| 68 | Nasutiter_Contig05403 | 2030936001 | Bacteria | 2875 |
| 69 | AustNasuHG_c1020262 | 3300000089 | Unclassified | 2168 |
| 70 | JGI24698J34947_10000288 | 3300002449 | Bacteria | 21810 |
| 71 | JGI24698J34947_10001814 | 3300002449 | Bacteria | 11394 |
| 72 | JGI24698J34947_10043727 | 3300002449 | Bacteria | 2295 |
| 73 | JGI24698J34947_10117884 | 3300002449 | Bacteria | 1158 |
| 74 | Ga0072941_1161352 | 3300005201 | Bacteria | 3891 |
| 75 | Ga0466731_089258 | 3300042622 | Bacteria | 2694 |
| 76 | Ga0466704_310562 | 3300042643 | Bacteria | 2817 |
| 77 | Ga0466719_434438 | 3300042606 | Unclassified | 2069 |
| 78 | Ga0466720_059875 | 3300042607 | Bacteria | 16278 |
| 79 | Ga0466720_224042 | 3300042607 | Unclassified | 4190 |
| 80 | Ga0466705_149616 | 3300042612 | Bacteria | 1123 |
| 81 | Ga0466732_191381 | 3300042656 | Unclassified | 4356 |
| 82 | Ga0123355_10011995 | 3300009826 | Unclassified | 13399 |
| 83 | Ga0466715_383277 | 3300042616 | Bacteria | 4409 |
| 84 | Ga0466718_169505 | 3300042617 | Unclassified | 3175 |
| 85 | Ga0466699_254535 | 3300042597 | Bacteria | 23948 |
| 86 | AustNasuHG_c1055222 | 3300000089 | Bacteria | 810 |
| 87 | JGI24698J34947_10002197 | 3300002449 | Bacteria | 10453 |
| 88 | JGI24695J34938_10086797 | 3300002450 | Unclassified | 1287 |
| 89 | Ga0072941_1000920 | 3300005201 | Bacteria | 16540 |
| 90 | Ga0466703_162636 | 3300042636 | Bacteria | 6149 |
| 91 | Ga0466704_120510 | 3300042643 | Bacteria | 12621 |
| 92 | Ga0466704_217526 | 3300042643 | Bacteria | 1267 |
| 93 | Ga0466720_052513 | 3300042607 | Bacteria | 8292 |
| 94 | Ga0123355_10001344 | 3300009826 | Bacteria | 34139 |
| 95 | Ga0123353_10000346 | 3300010167 | Bacteria | 56678 |
| 96 | Ga0123353_10398096 | 3300010167 | Bacteria | 2051 |
| 97 | Ga0466712_099650 | 3300042614 | Bacteria | 5538 |
| 98 | Ga0466718_042053 | 3300042617 | Bacteria | 3807 |
| 99 | Ga0264413_123655 | 3300024493 | Bacteria | 15514 |
| 100 | Ga0415639_051161 | 3300038395 | Bacteria | 5597 |
| 101 | Ga0466693_001793 | 3300042592 | Unclassified | 1959 |
| 102 | Ga0466699_322674 | 3300042597 | Bacteria | 75586 |
| 103 | AustNasuHG_c1047170 | 3300000089 | Bacteria | 964 |
| 104 | AustNasuHG_c1065407 | 3300000089 | Bacteria | 680 |
| 105 | Ga0123357_10001131 | 3300009784 | Bacteria | 27706 |
| 106 | Ga0466731_003631 | 3300042622 | Bacteria | 1445 |
| 107 | Ga0466716_164295 | 3300042605 | Bacteria | 1279 |
| 108 | Ga0466720_157967 | 3300042607 | Bacteria | 1670 |
| 109 | Ga0466712_212901 | 3300042614 | Bacteria | 4143 |
| 110 | Ga0466718_055400 | 3300042617 | Bacteria | 5081 |
| 111 | Ga0466718_065067 | 3300042617 | Unclassified | 2167 |
| 112 | Ga0466718_069797 | 3300042617 | Unclassified | 10814 |
| 113 | Ga0466718_102803 | 3300042617 | Bacteria | 4427 |
| 114 | Ga0415639_007684 | 3300038395 | Bacteria | 3382 |
| 115 | Ga0466691_006149 | 3300042593 | Bacteria | 3551 |
| 116 | AustNasuHG_c1028609 | 3300000089 | Bacteria | 1659 |
| 117 | JGI24698J34947_10009778 | 3300002449 | Bacteria | 5257 |
| 118 | JGI24698J34947_10030495 | 3300002449 | Bacteria | 2843 |
| 119 | JGI24695J34938_10022144 | 3300002450 | Bacteria | 3094 |
| 120 | JGI24695J34938_10085445 | 3300002450 | Bacteria | 1300 |
| 121 | Ga0072940_1009712 | 3300005200 | Bacteria | 2289 |
| 122 | Ga0466704_357006 | 3300042643 | Bacteria | 2239 |
| 123 | Ga0466716_296186 | 3300042605 | Bacteria | 2401 |
| 124 | Ga0466705_010601 | 3300042612 | Bacteria | 1362 |
| 125 | Ga0466705_354959 | 3300042612 | Archaea | 1623 |
| 126 | Ga0466732_319170 | 3300042656 | Bacteria | 1195 |
| 127 | Ga0466705_388015 | 3300042612 | Bacteria | 1702 |
| 128 | Ga0466712_077392 | 3300042614 | Unclassified | 2691 |
| 129 | Ga0466718_054363 | 3300042617 | Bacteria | 1179 |
| 130 | Ga0466718_057208 | 3300042617 | Bacteria | 3198 |
| 131 | Ga0466718_134865 | 3300042617 | Bacteria | 16850 |
| 132 | Ga0466723_015903 | 3300042618 | Bacteria | 1995 |
| 133 | Ga0264413_107108 | 3300024493 | Bacteria | 7254 |
| 134 | Ga0466690_355760 | 3300042590 | Bacteria | 1052 |
| 135 | Ga0466699_044826 | 3300042597 | Bacteria | 7987 |
| 136 | 2230954199 | 2228664003 | Bacteria | 18711 |
| 137 | AustNasuHG_c1010493 | 3300000089 | Bacteria | 3226 |
| 138 | JGI24698J34947_10001374 | 3300002449 | Bacteria | 12792 |
| 139 | Ga0466731_069358 | 3300042622 | Bacteria | 5233 |
| 140 | Ga0466727_348676 | 3300042655 | Bacteria | 1277 |
| 141 | Ga0466720_088628 | 3300042607 | Bacteria | 2127 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00239 | Resolvase | Resolvase, N terminal domain | 2 | 143 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.