Protein Family IF07924

Metagenome Isolate
319 Members
82 Samples
284 Scaffolds
551.02 Avg Length

🧬 Representative Sequence

ID
3300042617|Ga0466718_082032|Ga0466718_082032_179_2062
Length
621 aa
Sequence
MPCNGLFRRLYASITAACKTNKIFVIQFFQNINVLCITRYSFNIITFHIFYIGKFIFSLENFIYLFYSEKMKIRSKMFLVILPLLAETASYFHAVNGVTRLARQLLNFKLGELEKFAANQWSLLVENDYAGKPDMTEAAKKAVENYARSIILNDSEIIFAVDKSGSVAMASSAPGLLPDEEEPLLNLLLEENQSLQTAVIGGEKRIFQSFYFTPFDWYVLISEKEQVFYSDAKNIASQSIITLCAAVPAAIFLLILITRGLTNPLARIVKAMNKIIETVDLSSRVEVEYRDETGNLAMTFNKMAGELNRAYGQIKRYAFDAVLAGKKEERIRRIFQKYVPNDVIERFFASPEKMLVGDNRKLSILFSDIRSFTTISEGLAPDDLVNSLNRYFSGQVDIIYRRNGIVDKYIGDAIMAFWGAPEKHEDDALQSVLSGLEMIDAVAAFNVNQRRLGKCEFKIGIGLNYGEVTVGNIGSERKMDYTVIGDAVNLASRMEGLTKTYHCELLISEYLFETLRKTSPNSGLSYRLLDTVAVKGKTRGVRIFTVKKALSASEQKAWSLHNMGMKLYYIRSFSEAAGKFKEVLSILPGDFNAENLYNRCADYTVNPPPQNWDGVEIMKTK

πŸ“Š Sample Types

Isolate 11.0%
Metagenome 89.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 46.2%
Termitidae 30.0%
Kalotermitidae 17.5%
Rhinotermitidae 3.8%
Termopsidae 2.5%

🌳 Taxonomy

Archaea 1
Bacteria 301
Eukaryota 0
Viruses 0
Unclassified 17

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125682 Treponema sp. Lab288P1bin107 Isolate Unclassified
2 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
3 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
4 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
5 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
6 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
7 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
8 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
9 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
10 2781125639 Treponema sp. Co191P1bin44 Isolate Unclassified
11 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
12 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
13 2781125685 Treponema sp. Lab288P1bin13 Isolate Unclassified
14 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
15 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
16 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
17 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
18 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
19 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
20 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
21 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
22 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
23 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
24 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
25 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
26 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
27 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
28 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
29 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
30 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
31 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
32 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
33 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
34 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
35 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
36 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
37 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
38 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
39 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
40 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
41 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
42 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
43 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
44 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
45 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
46 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
47 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
48 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
49 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
50 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
51 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
52 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
53 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
54 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
55 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
56 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
57 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
58 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
59 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
60 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
61 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
62 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
63 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
64 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
65 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
66 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
67 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
68 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
69 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
70 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
71 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
72 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
73 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
74 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
75 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
76 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
77 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
78 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
79 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
80 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
81 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
82 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_216606 3300042656 Bacteria 6926
2 Ga0466716_037547 3300042605 Bacteria 18176
3 Ga0466719_030456 3300042606 Bacteria 2890
4 Ga0466719_250177 3300042606 Bacteria 4027
5 Ga0466720_026527 3300042607 Bacteria 13173
6 Ga0466720_189402 3300042607 Bacteria 39752
7 AustNasuHG_c1009974 3300000089 Bacteria 3321
8 JGI24698J34947_10000636 3300002449 Bacteria 16933
9 JGI24698J34947_10020771 3300002449 Unclassified 3535
10 JGI24695J34938_10000112 3300002450 Bacteria 72784
11 JGI24695J34938_10000325 3300002450 Bacteria 46894
12 JGI24695J34938_10000333 3300002450 Bacteria 46505
13 JGI24695J34938_10012556 3300002450 Bacteria 4483
14 Ga0072941_1004321 3300005201 Bacteria 5498
15 Ga0466692_154487 3300042591 Bacteria 7354
16 Ga0466694_020297 3300042594 Bacteria 14918
17 Ga0466699_240707 3300042597 Bacteria 23866
18 Ga0466699_270073 3300042597 Bacteria 19595
19 Ga0466699_397372 3300042597 Bacteria 3199
20 Ga0466712_018808 3300042614 Bacteria 4809
21 Ga0466712_130511 3300042614 Unclassified 4789
22 Ga0466715_006475 3300042616 Bacteria 6878
23 Ga0466718_004392 3300042617 Bacteria 3949
24 Ga0466723_047375 3300042618 Bacteria 3802
25 Ga0466704_192905 3300042643 Bacteria 4683
26 Ga0466732_158290 3300042656 Bacteria 4182
27 Ga0466732_205056 3300042656 Unclassified 3045
28 Ga0466700_091952 3300042600 Bacteria 2194
29 Ga0466720_025783 3300042607 Bacteria 15217
30 Ga0466720_103827 3300042607 Bacteria 28288
31 Ga0466720_114556 3300042607 Bacteria 7321
32 Ga0466720_130700 3300042607 Bacteria 5767
33 Ga0466720_237758 3300042607 Bacteria 6881
34 Ga0466722_040761 3300042609 Bacteria 6927
35 AustNasuHG_c1020707 3300000089 Bacteria 2138
36 JGI24698J34947_10022116 3300002449 Unclassified 3412
37 JGI24695J34938_10006233 3300002450 Bacteria 7235
38 JGI24695J34938_10006715 3300002450 Bacteria 6853
39 Ga0123357_10000428 3300009784 Bacteria 40312
40 Ga0415639_017061 3300038395 Bacteria 20806
41 Ga0466690_159872 3300042590 Bacteria 5707
42 Ga0466692_155266 3300042591 Bacteria 7776
43 Ga0466693_147459 3300042592 Bacteria 9052
44 Ga0466691_127318 3300042593 Bacteria 25819
45 Ga0466712_037275 3300042614 Bacteria 28135
46 Ga0466711_023043 3300042615 Bacteria 2529
47 Ga0466715_247335 3300042616 Bacteria 7025
48 Ga0466718_112998 3300042617 Bacteria 2949
49 Ga0466718_118611 3300042617 Bacteria 2704
50 Ga0466718_152635 3300042617 Bacteria 1903
51 Ga0466731_163389 3300042622 Bacteria 5163
52 Ga0466731_339199 3300042622 Bacteria 43843
53 Ga0466704_162833 3300042643 Bacteria 5824
54 Ga0466704_515711 3300042643 Bacteria 17863
55 Ga0466704_557368 3300042643 Bacteria 2811
56 Ga0466709_222056 3300042648 Bacteria 11074
57 Ga0466709_266038 3300042648 Bacteria 4998
58 Ga0466708_037076 3300042652 Bacteria 7681
59 Ga0123357_10093670 3300009784 Bacteria 3903
60 Ga0123356_10001382 3300010049 Bacteria 26896
61 Ga0123356_10008411 3300010049 Bacteria 10260
62 Ga0466732_071609 3300042656 Bacteria 19420
63 Ga0466732_157321 3300042656 Bacteria 19977
64 Ga0466732_328882 3300042656 Bacteria 7869
65 Ga0466700_256122 3300042600 Bacteria 2179
66 Ga0466700_491472 3300042600 Bacteria 3224
67 Ga0466720_014265 3300042607 Bacteria 4921
68 Ga0466720_088854 3300042607 Bacteria 7831
69 Ga0466720_113262 3300042607 Bacteria 3947
70 Ga0466722_071394 3300042609 Bacteria 2737
71 Ga0466722_120324 3300042609 Bacteria 11158
72 Ga0466722_153951 3300042609 Bacteria 6598
73 Ga0466722_251406 3300042609 Bacteria 2273
74 AustNasuHG_c1000249 3300000089 Bacteria 18194
75 AustNasuHG_c1002075 3300000089 Bacteria 7242
76 AustNasuHG_c1011458 3300000089 Bacteria 3074
77 JGI24698J34947_10002526 3300002449 Bacteria 9874
78 JGI24698J34947_10008704 3300002449 Bacteria 5566
79 JGI24698J34947_10025683 3300002449 Bacteria 3133
80 JGI24695J34938_10000300 3300002450 Bacteria 48880
81 JGI24695J34938_10000741 3300002450 Bacteria 30647
82 JGI24695J34938_10004766 3300002450 Bacteria 8754
83 JGI24695J34938_10022448 3300002450 Bacteria 3065
84 Ga0072941_1005931 3300005201 Bacteria 16771
85 Ga0072941_1021173 3300005201 Bacteria 19796
86 Ga0072941_1039466 3300005201 Bacteria 2311
87 Ga0466693_032922 3300042592 Bacteria 5998
88 Ga0466694_359883 3300042594 Bacteria 4340
89 Ga0466699_036963 3300042597 Bacteria 13853
90 Ga0466712_043625 3300042614 Bacteria 22329
91 Ga0466712_206114 3300042614 Bacteria 8993
92 Ga0466711_042263 3300042615 Bacteria 5481
93 Ga0466718_019463 3300042617 Bacteria 34805
94 Ga0466718_068159 3300042617 Bacteria 2906
95 Ga0466718_087399 3300042617 Bacteria 20374
96 Ga0466726_123070 3300042619 Bacteria 1821
97 Ga0466728_083325 3300042620 Bacteria 7581
98 Ga0466702_250280 3300042635 Bacteria 23290
99 Ga0466708_056106 3300042652 Bacteria 4689
100 Ga0123356_10001145 3300010049 Bacteria 29294
101 Ga0123356_10018221 3300010049 Bacteria 6668
102 Ga0123356_10054067 3300010049 Unclassified 3739
103 Ga0123353_10250635 3300010167 Unclassified 2742
104 Ga0123353_10278273 3300010167 Bacteria 2572
105 Ga0466732_016893 3300042656 Bacteria 22834
106 Ga0466716_106220 3300042605 Bacteria 21500
107 Ga0466720_030990 3300042607 Bacteria 12575
108 Ga0466720_065954 3300042607 Bacteria 4723
109 Ga0466720_105228 3300042607 Bacteria 20857
110 Ga0466720_209099 3300042607 Bacteria 12771
111 Ga0466721_218731 3300042608 Bacteria 30688
112 Ga0466722_072836 3300042609 Bacteria 4898
113 Ga0466722_145384 3300042609 Bacteria 15662
114 AustNasuHG_c1002787 3300000089 Bacteria 6311
115 AustNasuHG_c1010848 3300000089 Unclassified 3166
116 JGI24698J34947_10000101 3300002449 Bacteria 29683
117 JGI24698J34947_10000241 3300002449 Bacteria 22787
118 JGI24698J34947_10004557 3300002449 Bacteria 7550
119 JGI24698J34947_10010907 3300002449 Bacteria 4987
120 JGI24695J34938_10001711 3300002450 Bacteria 18143
121 JGI24695J34938_10001898 3300002450 Bacteria 16909
122 JGI24695J34938_10004616 3300002450 Bacteria 8950
123 JGI24695J34938_10016561 3300002450 Bacteria 3745
124 Ga0072941_1004401 3300005201 Bacteria 26179
125 Ga0466690_001465 3300042590 Bacteria 7758
126 Ga0466690_048663 3300042590 Bacteria 11095
127 Ga0466694_023614 3300042594 Bacteria 10852
128 Ga0466699_017953 3300042597 Bacteria 4513
129 Ga0466699_071252 3300042597 Bacteria 9127
130 Ga0466699_203771 3300042597 Bacteria 13304
131 Ga0466712_023866 3300042614 Bacteria 10425
132 Ga0466712_130872 3300042614 Unclassified 2500
133 Ga0466712_160588 3300042614 Bacteria 10859
134 Ga0466712_309501 3300042614 Bacteria 14310
135 Ga0466712_322727 3300042614 Bacteria 6854
136 Ga0466711_006796 3300042615 Bacteria 9120
137 Ga0466718_046207 3300042617 Bacteria 64941
138 Ga0466731_234989 3300042622 Bacteria 3839
139 Ga0466735_052011 3300042624 Bacteria 4683
140 Ga0466704_223742 3300042643 Bacteria 2060
141 Ga0466704_465796 3300042643 Bacteria 55836
142 Ga0123356_10003520 3300010049 Bacteria 16374
143 Ga0123356_10003723 3300010049 Bacteria 15891
144 Ga0123356_10035626 3300010049 Bacteria 4648
145 Ga0466705_182799 3300042612 Bacteria 19726
146 Ga0466732_026465 3300042656 Unclassified 2064
147 Ga0466707_244065 3300042601 Bacteria 8993
148 Ga0466720_091008 3300042607 Bacteria 8224
149 Ga0466722_007551 3300042609 Bacteria 5653
150 AustNasuHG_c1000106 3300000089 Bacteria 25236
151 AustNasuHG_c1018991 3300000089 Unclassified 2261
152 JGI24695J34938_10004856 3300002450 Bacteria 8623
153 JGI24695J34938_10033129 3300002450 Bacteria 2380
154 JGI24700J35501_10930399 3300002508 Bacteria 13619
155 Ga0072941_1006155 3300005201 Bacteria 5849
156 Ga0072941_1067173 3300005201 Bacteria 6118
157 Ga0415639_042598 3300038395 Bacteria 3576
158 Ga0466691_036181 3300042593 Bacteria 10261
159 Ga0466691_100788 3300042593 Bacteria 5619
160 Ga0466694_160807 3300042594 Bacteria 42039
161 Ga0466694_217547 3300042594 Bacteria 2485
162 Ga0466699_055213 3300042597 Bacteria 6114
163 Ga0466699_110518 3300042597 Bacteria 5309
164 Ga0466699_425188 3300042597 Bacteria 97421
165 Ga0466712_247842 3300042614 Bacteria 4776
166 Ga0466712_282237 3300042614 Unclassified 2174
167 Ga0466715_063212 3300042616 Bacteria 11433
168 Ga0466718_007819 3300042617 Bacteria 4638
169 Ga0466723_016129 3300042618 Bacteria 4627
170 Ga0466728_110755 3300042620 Bacteria 7665
171 Ga0466728_351218 3300042620 Bacteria 7966
172 Ga0466702_047377 3300042635 Bacteria 2873
173 Ga0466708_241910 3300042652 Bacteria 8918
174 Ga0123356_10000067 3300010049 Bacteria 109410
175 Ga0123356_10020187 3300010049 Bacteria 6308
176 Ga0123356_10076008 3300010049 Bacteria 3165
177 Ga0466705_009366 3300042612 Bacteria 4701
178 Ga0466705_157102 3300042612 Bacteria 13230
179 Ga0466713_110096 3300042602 Bacteria 24674
180 Ga0466720_034318 3300042607 Bacteria 32841
181 Ga0466720_090368 3300042607 Bacteria 39301
182 Ga0466720_115798 3300042607 Unclassified 4983
183 Ga0466720_137060 3300042607 Bacteria 2960
184 Ga0466720_159479 3300042607 Bacteria 7119
185 JGI24698J34947_10001788 3300002449 Bacteria 11467
186 JGI24698J34947_10002461 3300002449 Bacteria 9988
187 JGI24698J34947_10007767 3300002449 Bacteria 5891
188 JGI24698J34947_10008590 3300002449 Unclassified 5607
189 JGI24695J34938_10000363 3300002450 Bacteria 44964
190 JGI24695J34938_10011929 3300002450 Unclassified 4640
191 Ga0072941_1004320 3300005201 Bacteria 5374
192 Ga0072941_1014797 3300005201 Bacteria 7363
193 Ga0074263_111292 3300005485 Bacteria 2659
194 Ga0264413_118629 3300024493 Unclassified 6369
195 Ga0415639_021948 3300038395 Bacteria 11438
196 Ga0466692_059133 3300042591 Bacteria 3147
197 Ga0466694_069804 3300042594 Bacteria 8051
198 Ga0466694_168444 3300042594 Bacteria 2596
199 Ga0466694_177823 3300042594 Bacteria 3332
200 Ga0466696_039309 3300042596 Bacteria 9868
201 Ga0466696_205859 3300042596 Bacteria 11869
202 Ga0466699_079157 3300042597 Bacteria 20335
203 Ga0466699_223406 3300042597 Bacteria 4495
204 Ga0466712_011784 3300042614 Bacteria 50228
205 Ga0466712_087505 3300042614 Bacteria 8346
206 Ga0466712_092678 3300042614 Bacteria 11730
207 Ga0466715_158367 3300042616 Bacteria 13665
208 Ga0466718_025078 3300042617 Bacteria 25020
209 Ga0466718_044326 3300042617 Bacteria 6562
210 Ga0466718_082032 3300042617 Bacteria 2306
211 Ga0466723_165981 3300042618 Bacteria 6877
212 Ga0466703_133842 3300042636 Bacteria 9678
213 Ga0466708_158435 3300042652 Bacteria 10344
214 Ga0123357_10023969 3300009784 Bacteria 8208
215 Ga0123356_10000554 3300010049 Bacteria 41448
216 Ga0123356_10011330 3300010049 Bacteria 8699
217 Ga0123356_10088824 3300010049 Bacteria 2939
218 Ga0123353_10291537 3300010167 Bacteria 2498
219 Ga0466705_228041 3300042612 Bacteria 9385
220 Ga0466705_296259 3300042612 Bacteria 2370
221 Ga0466716_410411 3300042605 Bacteria 3596
222 Ga0466719_126770 3300042606 Bacteria 8851
223 Ga0466719_301996 3300042606 Bacteria 12195
224 Ga0466722_214842 3300042609 Bacteria 6410
225 AustNasuHG_c1003398 3300000089 Bacteria 5749
226 JGI24698J34947_10016502 3300002449 Bacteria 4008
227 JGI24698J34947_10029936 3300002449 Bacteria 2874
228 JGI24695J34938_10000080 3300002450 Bacteria 82616
229 JGI24695J34938_10000442 3300002450 Bacteria 40061
230 JGI24695J34938_10002312 3300002450 Bacteria 14667
231 JGI24695J34938_10018712 3300002450 Bacteria 3452
232 JGI24702J35022_10002500 3300002462 Bacteria 11224
233 Ga0072941_1158910 3300005201 Bacteria 4018
234 Ga0264413_102462 3300024493 Bacteria 36892
235 Ga0264413_118608 3300024493 Bacteria 6120
236 Ga0466693_219252 3300042592 Bacteria 11724
237 Ga0466694_006451 3300042594 Bacteria 18798
238 Ga0466694_017850 3300042594 Bacteria 32795
239 Ga0466694_124512 3300042594 Bacteria 16958
240 Ga0466694_164873 3300042594 Bacteria 42610
241 Ga0466696_182025 3300042596 Bacteria 4244
242 Ga0466699_016273 3300042597 Bacteria 38876
243 Ga0466712_067284 3300042614 Bacteria 2215
244 Ga0466711_173251 3300042615 Bacteria 3534
245 Ga0466715_119905 3300042616 Unclassified 11536
246 Ga0466718_118554 3300042617 Bacteria 3097
247 Ga0466704_579526 3300042643 Bacteria 2442
248 Ga0466709_337580 3300042648 Bacteria 6644
249 Ga0466732_231902 3300042656 Bacteria 5151
250 Ga0466719_324180 3300042606 Bacteria 4279
251 Ga0466719_378374 3300042606 Bacteria 2143
252 Ga0466720_079348 3300042607 Bacteria 3608
253 Ga0466720_144118 3300042607 Bacteria 25436
254 JGI24698J34947_10025196 3300002449 Bacteria 3168
255 JGI24695J34938_10000072 3300002450 Bacteria 85833
256 JGI24695J34938_10000081 3300002450 Bacteria 82371
257 JGI24695J34938_10000595 3300002450 Bacteria 34813
258 JGI24695J34938_10001772 3300002450 Bacteria 17817
259 JGI24695J34938_10001832 3300002450 Bacteria 17374
260 JGI24695J34938_10002256 3300002450 Bacteria 14911
261 JGI24695J34938_10007387 3300002450 Bacteria 6439
262 JGI24695J34938_10022929 3300002450 Bacteria 3018
263 JGI24702J35022_10002330 3300002462 Bacteria 11615
264 Ga0072940_1050513 3300005200 Bacteria 9126
265 Ga0264413_111425 3300024493 Bacteria 62805
266 Ga0466690_064030 3300042590 Bacteria 2630
267 Ga0466692_159060 3300042591 Bacteria 7070
268 Ga0466693_293912 3300042592 Bacteria 55262
269 Ga0466691_109089 3300042593 Bacteria 5790
270 Ga0466695_287473 3300042595 Bacteria 18164
271 Ga0466699_369078 3300042597 Bacteria 14583
272 Ga0466712_002757 3300042614 Bacteria 12771
273 Ga0466712_055787 3300042614 Bacteria 25522
274 Ga0466712_093993 3300042614 Bacteria 15046
275 Ga0466715_047371 3300042616 Bacteria 26169
276 Ga0466715_085390 3300042616 Bacteria 2209
277 Ga0466718_054285 3300042617 Archaea 3704
278 Ga0466723_210192 3300042618 Unclassified 5041
279 Ga0466726_159305 3300042619 Bacteria 11235
280 Ga0466728_382045 3300042620 Bacteria 5064
281 Ga0466729_062401 3300042621 Bacteria 1752
282 Ga0466703_166664 3300042636 Bacteria 9119
283 Ga0123355_10042857 3300009826 Bacteria 7366
284 Ga0123356_10004995 3300010049 Bacteria 13603

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00672 HAMP HAMP domain 256 308 0.96
PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain 361 539 0.87

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.