Protein Family IF07924
Metagenome
Isolate
319
Members
82
Samples
284
Scaffolds
551.02
Avg Length
Representative Sequence
- ID
- 3300042617|Ga0466718_082032|Ga0466718_082032_179_2062
- Length
- 621 aa
- Sequence
- MPCNGLFRRLYASITAACKTNKIFVIQFFQNINVLCITRYSFNIITFHIFYIGKFIFSLENFIYLFYSEKMKIRSKMFLVILPLLAETASYFHAVNGVTRLARQLLNFKLGELEKFAANQWSLLVENDYAGKPDMTEAAKKAVENYARSIILNDSEIIFAVDKSGSVAMASSAPGLLPDEEEPLLNLLLEENQSLQTAVIGGEKRIFQSFYFTPFDWYVLISEKEQVFYSDAKNIASQSIITLCAAVPAAIFLLILITRGLTNPLARIVKAMNKIIETVDLSSRVEVEYRDETGNLAMTFNKMAGELNRAYGQIKRYAFDAVLAGKKEERIRRIFQKYVPNDVIERFFASPEKMLVGDNRKLSILFSDIRSFTTISEGLAPDDLVNSLNRYFSGQVDIIYRRNGIVDKYIGDAIMAFWGAPEKHEDDALQSVLSGLEMIDAVAAFNVNQRRLGKCEFKIGIGLNYGEVTVGNIGSERKMDYTVIGDAVNLASRMEGLTKTYHCELLISEYLFETLRKTSPNSGLSYRLLDTVAVKGKTRGVRIFTVKKALSASEQKAWSLHNMGMKLYYIRSFSEAAGKFKEVLSILPGDFNAENLYNRCADYTVNPPPQNWDGVEIMKTK
Sample Types
Isolate
11.0%
Metagenome
89.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
46.2%
Termitidae
30.0%
Kalotermitidae
17.5%
Rhinotermitidae
3.8%
Termopsidae
2.5%
Taxonomy
Archaea
1
Bacteria
301
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 2 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 3 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 4 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 5 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 6 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 7 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 8 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 9 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 10 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 11 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 12 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 13 | 2781125685 | Treponema sp. Lab288P1bin13 | Isolate | Unclassified |
| 14 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 15 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 16 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 17 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 18 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 19 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 20 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 21 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 22 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 23 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 24 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 25 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 26 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 27 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 28 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 29 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 30 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 31 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 32 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 33 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 34 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 35 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 36 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 37 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 38 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 39 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 40 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 41 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 42 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 43 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 44 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 45 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 46 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 47 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 48 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 49 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 50 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 51 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 52 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 53 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 54 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 55 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 56 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 57 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 58 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 59 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 60 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 61 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 62 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 63 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 64 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 65 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 66 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 67 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 68 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 69 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 70 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 71 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 72 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 73 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 74 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 75 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 76 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 77 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 78 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 79 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 80 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 81 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 82 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_216606 | 3300042656 | Bacteria | 6926 |
| 2 | Ga0466716_037547 | 3300042605 | Bacteria | 18176 |
| 3 | Ga0466719_030456 | 3300042606 | Bacteria | 2890 |
| 4 | Ga0466719_250177 | 3300042606 | Bacteria | 4027 |
| 5 | Ga0466720_026527 | 3300042607 | Bacteria | 13173 |
| 6 | Ga0466720_189402 | 3300042607 | Bacteria | 39752 |
| 7 | AustNasuHG_c1009974 | 3300000089 | Bacteria | 3321 |
| 8 | JGI24698J34947_10000636 | 3300002449 | Bacteria | 16933 |
| 9 | JGI24698J34947_10020771 | 3300002449 | Unclassified | 3535 |
| 10 | JGI24695J34938_10000112 | 3300002450 | Bacteria | 72784 |
| 11 | JGI24695J34938_10000325 | 3300002450 | Bacteria | 46894 |
| 12 | JGI24695J34938_10000333 | 3300002450 | Bacteria | 46505 |
| 13 | JGI24695J34938_10012556 | 3300002450 | Bacteria | 4483 |
| 14 | Ga0072941_1004321 | 3300005201 | Bacteria | 5498 |
| 15 | Ga0466692_154487 | 3300042591 | Bacteria | 7354 |
| 16 | Ga0466694_020297 | 3300042594 | Bacteria | 14918 |
| 17 | Ga0466699_240707 | 3300042597 | Bacteria | 23866 |
| 18 | Ga0466699_270073 | 3300042597 | Bacteria | 19595 |
| 19 | Ga0466699_397372 | 3300042597 | Bacteria | 3199 |
| 20 | Ga0466712_018808 | 3300042614 | Bacteria | 4809 |
| 21 | Ga0466712_130511 | 3300042614 | Unclassified | 4789 |
| 22 | Ga0466715_006475 | 3300042616 | Bacteria | 6878 |
| 23 | Ga0466718_004392 | 3300042617 | Bacteria | 3949 |
| 24 | Ga0466723_047375 | 3300042618 | Bacteria | 3802 |
| 25 | Ga0466704_192905 | 3300042643 | Bacteria | 4683 |
| 26 | Ga0466732_158290 | 3300042656 | Bacteria | 4182 |
| 27 | Ga0466732_205056 | 3300042656 | Unclassified | 3045 |
| 28 | Ga0466700_091952 | 3300042600 | Bacteria | 2194 |
| 29 | Ga0466720_025783 | 3300042607 | Bacteria | 15217 |
| 30 | Ga0466720_103827 | 3300042607 | Bacteria | 28288 |
| 31 | Ga0466720_114556 | 3300042607 | Bacteria | 7321 |
| 32 | Ga0466720_130700 | 3300042607 | Bacteria | 5767 |
| 33 | Ga0466720_237758 | 3300042607 | Bacteria | 6881 |
| 34 | Ga0466722_040761 | 3300042609 | Bacteria | 6927 |
| 35 | AustNasuHG_c1020707 | 3300000089 | Bacteria | 2138 |
| 36 | JGI24698J34947_10022116 | 3300002449 | Unclassified | 3412 |
| 37 | JGI24695J34938_10006233 | 3300002450 | Bacteria | 7235 |
| 38 | JGI24695J34938_10006715 | 3300002450 | Bacteria | 6853 |
| 39 | Ga0123357_10000428 | 3300009784 | Bacteria | 40312 |
| 40 | Ga0415639_017061 | 3300038395 | Bacteria | 20806 |
| 41 | Ga0466690_159872 | 3300042590 | Bacteria | 5707 |
| 42 | Ga0466692_155266 | 3300042591 | Bacteria | 7776 |
| 43 | Ga0466693_147459 | 3300042592 | Bacteria | 9052 |
| 44 | Ga0466691_127318 | 3300042593 | Bacteria | 25819 |
| 45 | Ga0466712_037275 | 3300042614 | Bacteria | 28135 |
| 46 | Ga0466711_023043 | 3300042615 | Bacteria | 2529 |
| 47 | Ga0466715_247335 | 3300042616 | Bacteria | 7025 |
| 48 | Ga0466718_112998 | 3300042617 | Bacteria | 2949 |
| 49 | Ga0466718_118611 | 3300042617 | Bacteria | 2704 |
| 50 | Ga0466718_152635 | 3300042617 | Bacteria | 1903 |
| 51 | Ga0466731_163389 | 3300042622 | Bacteria | 5163 |
| 52 | Ga0466731_339199 | 3300042622 | Bacteria | 43843 |
| 53 | Ga0466704_162833 | 3300042643 | Bacteria | 5824 |
| 54 | Ga0466704_515711 | 3300042643 | Bacteria | 17863 |
| 55 | Ga0466704_557368 | 3300042643 | Bacteria | 2811 |
| 56 | Ga0466709_222056 | 3300042648 | Bacteria | 11074 |
| 57 | Ga0466709_266038 | 3300042648 | Bacteria | 4998 |
| 58 | Ga0466708_037076 | 3300042652 | Bacteria | 7681 |
| 59 | Ga0123357_10093670 | 3300009784 | Bacteria | 3903 |
| 60 | Ga0123356_10001382 | 3300010049 | Bacteria | 26896 |
| 61 | Ga0123356_10008411 | 3300010049 | Bacteria | 10260 |
| 62 | Ga0466732_071609 | 3300042656 | Bacteria | 19420 |
| 63 | Ga0466732_157321 | 3300042656 | Bacteria | 19977 |
| 64 | Ga0466732_328882 | 3300042656 | Bacteria | 7869 |
| 65 | Ga0466700_256122 | 3300042600 | Bacteria | 2179 |
| 66 | Ga0466700_491472 | 3300042600 | Bacteria | 3224 |
| 67 | Ga0466720_014265 | 3300042607 | Bacteria | 4921 |
| 68 | Ga0466720_088854 | 3300042607 | Bacteria | 7831 |
| 69 | Ga0466720_113262 | 3300042607 | Bacteria | 3947 |
| 70 | Ga0466722_071394 | 3300042609 | Bacteria | 2737 |
| 71 | Ga0466722_120324 | 3300042609 | Bacteria | 11158 |
| 72 | Ga0466722_153951 | 3300042609 | Bacteria | 6598 |
| 73 | Ga0466722_251406 | 3300042609 | Bacteria | 2273 |
| 74 | AustNasuHG_c1000249 | 3300000089 | Bacteria | 18194 |
| 75 | AustNasuHG_c1002075 | 3300000089 | Bacteria | 7242 |
| 76 | AustNasuHG_c1011458 | 3300000089 | Bacteria | 3074 |
| 77 | JGI24698J34947_10002526 | 3300002449 | Bacteria | 9874 |
| 78 | JGI24698J34947_10008704 | 3300002449 | Bacteria | 5566 |
| 79 | JGI24698J34947_10025683 | 3300002449 | Bacteria | 3133 |
| 80 | JGI24695J34938_10000300 | 3300002450 | Bacteria | 48880 |
| 81 | JGI24695J34938_10000741 | 3300002450 | Bacteria | 30647 |
| 82 | JGI24695J34938_10004766 | 3300002450 | Bacteria | 8754 |
| 83 | JGI24695J34938_10022448 | 3300002450 | Bacteria | 3065 |
| 84 | Ga0072941_1005931 | 3300005201 | Bacteria | 16771 |
| 85 | Ga0072941_1021173 | 3300005201 | Bacteria | 19796 |
| 86 | Ga0072941_1039466 | 3300005201 | Bacteria | 2311 |
| 87 | Ga0466693_032922 | 3300042592 | Bacteria | 5998 |
| 88 | Ga0466694_359883 | 3300042594 | Bacteria | 4340 |
| 89 | Ga0466699_036963 | 3300042597 | Bacteria | 13853 |
| 90 | Ga0466712_043625 | 3300042614 | Bacteria | 22329 |
| 91 | Ga0466712_206114 | 3300042614 | Bacteria | 8993 |
| 92 | Ga0466711_042263 | 3300042615 | Bacteria | 5481 |
| 93 | Ga0466718_019463 | 3300042617 | Bacteria | 34805 |
| 94 | Ga0466718_068159 | 3300042617 | Bacteria | 2906 |
| 95 | Ga0466718_087399 | 3300042617 | Bacteria | 20374 |
| 96 | Ga0466726_123070 | 3300042619 | Bacteria | 1821 |
| 97 | Ga0466728_083325 | 3300042620 | Bacteria | 7581 |
| 98 | Ga0466702_250280 | 3300042635 | Bacteria | 23290 |
| 99 | Ga0466708_056106 | 3300042652 | Bacteria | 4689 |
| 100 | Ga0123356_10001145 | 3300010049 | Bacteria | 29294 |
| 101 | Ga0123356_10018221 | 3300010049 | Bacteria | 6668 |
| 102 | Ga0123356_10054067 | 3300010049 | Unclassified | 3739 |
| 103 | Ga0123353_10250635 | 3300010167 | Unclassified | 2742 |
| 104 | Ga0123353_10278273 | 3300010167 | Bacteria | 2572 |
| 105 | Ga0466732_016893 | 3300042656 | Bacteria | 22834 |
| 106 | Ga0466716_106220 | 3300042605 | Bacteria | 21500 |
| 107 | Ga0466720_030990 | 3300042607 | Bacteria | 12575 |
| 108 | Ga0466720_065954 | 3300042607 | Bacteria | 4723 |
| 109 | Ga0466720_105228 | 3300042607 | Bacteria | 20857 |
| 110 | Ga0466720_209099 | 3300042607 | Bacteria | 12771 |
| 111 | Ga0466721_218731 | 3300042608 | Bacteria | 30688 |
| 112 | Ga0466722_072836 | 3300042609 | Bacteria | 4898 |
| 113 | Ga0466722_145384 | 3300042609 | Bacteria | 15662 |
| 114 | AustNasuHG_c1002787 | 3300000089 | Bacteria | 6311 |
| 115 | AustNasuHG_c1010848 | 3300000089 | Unclassified | 3166 |
| 116 | JGI24698J34947_10000101 | 3300002449 | Bacteria | 29683 |
| 117 | JGI24698J34947_10000241 | 3300002449 | Bacteria | 22787 |
| 118 | JGI24698J34947_10004557 | 3300002449 | Bacteria | 7550 |
| 119 | JGI24698J34947_10010907 | 3300002449 | Bacteria | 4987 |
| 120 | JGI24695J34938_10001711 | 3300002450 | Bacteria | 18143 |
| 121 | JGI24695J34938_10001898 | 3300002450 | Bacteria | 16909 |
| 122 | JGI24695J34938_10004616 | 3300002450 | Bacteria | 8950 |
| 123 | JGI24695J34938_10016561 | 3300002450 | Bacteria | 3745 |
| 124 | Ga0072941_1004401 | 3300005201 | Bacteria | 26179 |
| 125 | Ga0466690_001465 | 3300042590 | Bacteria | 7758 |
| 126 | Ga0466690_048663 | 3300042590 | Bacteria | 11095 |
| 127 | Ga0466694_023614 | 3300042594 | Bacteria | 10852 |
| 128 | Ga0466699_017953 | 3300042597 | Bacteria | 4513 |
| 129 | Ga0466699_071252 | 3300042597 | Bacteria | 9127 |
| 130 | Ga0466699_203771 | 3300042597 | Bacteria | 13304 |
| 131 | Ga0466712_023866 | 3300042614 | Bacteria | 10425 |
| 132 | Ga0466712_130872 | 3300042614 | Unclassified | 2500 |
| 133 | Ga0466712_160588 | 3300042614 | Bacteria | 10859 |
| 134 | Ga0466712_309501 | 3300042614 | Bacteria | 14310 |
| 135 | Ga0466712_322727 | 3300042614 | Bacteria | 6854 |
| 136 | Ga0466711_006796 | 3300042615 | Bacteria | 9120 |
| 137 | Ga0466718_046207 | 3300042617 | Bacteria | 64941 |
| 138 | Ga0466731_234989 | 3300042622 | Bacteria | 3839 |
| 139 | Ga0466735_052011 | 3300042624 | Bacteria | 4683 |
| 140 | Ga0466704_223742 | 3300042643 | Bacteria | 2060 |
| 141 | Ga0466704_465796 | 3300042643 | Bacteria | 55836 |
| 142 | Ga0123356_10003520 | 3300010049 | Bacteria | 16374 |
| 143 | Ga0123356_10003723 | 3300010049 | Bacteria | 15891 |
| 144 | Ga0123356_10035626 | 3300010049 | Bacteria | 4648 |
| 145 | Ga0466705_182799 | 3300042612 | Bacteria | 19726 |
| 146 | Ga0466732_026465 | 3300042656 | Unclassified | 2064 |
| 147 | Ga0466707_244065 | 3300042601 | Bacteria | 8993 |
| 148 | Ga0466720_091008 | 3300042607 | Bacteria | 8224 |
| 149 | Ga0466722_007551 | 3300042609 | Bacteria | 5653 |
| 150 | AustNasuHG_c1000106 | 3300000089 | Bacteria | 25236 |
| 151 | AustNasuHG_c1018991 | 3300000089 | Unclassified | 2261 |
| 152 | JGI24695J34938_10004856 | 3300002450 | Bacteria | 8623 |
| 153 | JGI24695J34938_10033129 | 3300002450 | Bacteria | 2380 |
| 154 | JGI24700J35501_10930399 | 3300002508 | Bacteria | 13619 |
| 155 | Ga0072941_1006155 | 3300005201 | Bacteria | 5849 |
| 156 | Ga0072941_1067173 | 3300005201 | Bacteria | 6118 |
| 157 | Ga0415639_042598 | 3300038395 | Bacteria | 3576 |
| 158 | Ga0466691_036181 | 3300042593 | Bacteria | 10261 |
| 159 | Ga0466691_100788 | 3300042593 | Bacteria | 5619 |
| 160 | Ga0466694_160807 | 3300042594 | Bacteria | 42039 |
| 161 | Ga0466694_217547 | 3300042594 | Bacteria | 2485 |
| 162 | Ga0466699_055213 | 3300042597 | Bacteria | 6114 |
| 163 | Ga0466699_110518 | 3300042597 | Bacteria | 5309 |
| 164 | Ga0466699_425188 | 3300042597 | Bacteria | 97421 |
| 165 | Ga0466712_247842 | 3300042614 | Bacteria | 4776 |
| 166 | Ga0466712_282237 | 3300042614 | Unclassified | 2174 |
| 167 | Ga0466715_063212 | 3300042616 | Bacteria | 11433 |
| 168 | Ga0466718_007819 | 3300042617 | Bacteria | 4638 |
| 169 | Ga0466723_016129 | 3300042618 | Bacteria | 4627 |
| 170 | Ga0466728_110755 | 3300042620 | Bacteria | 7665 |
| 171 | Ga0466728_351218 | 3300042620 | Bacteria | 7966 |
| 172 | Ga0466702_047377 | 3300042635 | Bacteria | 2873 |
| 173 | Ga0466708_241910 | 3300042652 | Bacteria | 8918 |
| 174 | Ga0123356_10000067 | 3300010049 | Bacteria | 109410 |
| 175 | Ga0123356_10020187 | 3300010049 | Bacteria | 6308 |
| 176 | Ga0123356_10076008 | 3300010049 | Bacteria | 3165 |
| 177 | Ga0466705_009366 | 3300042612 | Bacteria | 4701 |
| 178 | Ga0466705_157102 | 3300042612 | Bacteria | 13230 |
| 179 | Ga0466713_110096 | 3300042602 | Bacteria | 24674 |
| 180 | Ga0466720_034318 | 3300042607 | Bacteria | 32841 |
| 181 | Ga0466720_090368 | 3300042607 | Bacteria | 39301 |
| 182 | Ga0466720_115798 | 3300042607 | Unclassified | 4983 |
| 183 | Ga0466720_137060 | 3300042607 | Bacteria | 2960 |
| 184 | Ga0466720_159479 | 3300042607 | Bacteria | 7119 |
| 185 | JGI24698J34947_10001788 | 3300002449 | Bacteria | 11467 |
| 186 | JGI24698J34947_10002461 | 3300002449 | Bacteria | 9988 |
| 187 | JGI24698J34947_10007767 | 3300002449 | Bacteria | 5891 |
| 188 | JGI24698J34947_10008590 | 3300002449 | Unclassified | 5607 |
| 189 | JGI24695J34938_10000363 | 3300002450 | Bacteria | 44964 |
| 190 | JGI24695J34938_10011929 | 3300002450 | Unclassified | 4640 |
| 191 | Ga0072941_1004320 | 3300005201 | Bacteria | 5374 |
| 192 | Ga0072941_1014797 | 3300005201 | Bacteria | 7363 |
| 193 | Ga0074263_111292 | 3300005485 | Bacteria | 2659 |
| 194 | Ga0264413_118629 | 3300024493 | Unclassified | 6369 |
| 195 | Ga0415639_021948 | 3300038395 | Bacteria | 11438 |
| 196 | Ga0466692_059133 | 3300042591 | Bacteria | 3147 |
| 197 | Ga0466694_069804 | 3300042594 | Bacteria | 8051 |
| 198 | Ga0466694_168444 | 3300042594 | Bacteria | 2596 |
| 199 | Ga0466694_177823 | 3300042594 | Bacteria | 3332 |
| 200 | Ga0466696_039309 | 3300042596 | Bacteria | 9868 |
| 201 | Ga0466696_205859 | 3300042596 | Bacteria | 11869 |
| 202 | Ga0466699_079157 | 3300042597 | Bacteria | 20335 |
| 203 | Ga0466699_223406 | 3300042597 | Bacteria | 4495 |
| 204 | Ga0466712_011784 | 3300042614 | Bacteria | 50228 |
| 205 | Ga0466712_087505 | 3300042614 | Bacteria | 8346 |
| 206 | Ga0466712_092678 | 3300042614 | Bacteria | 11730 |
| 207 | Ga0466715_158367 | 3300042616 | Bacteria | 13665 |
| 208 | Ga0466718_025078 | 3300042617 | Bacteria | 25020 |
| 209 | Ga0466718_044326 | 3300042617 | Bacteria | 6562 |
| 210 | Ga0466718_082032 | 3300042617 | Bacteria | 2306 |
| 211 | Ga0466723_165981 | 3300042618 | Bacteria | 6877 |
| 212 | Ga0466703_133842 | 3300042636 | Bacteria | 9678 |
| 213 | Ga0466708_158435 | 3300042652 | Bacteria | 10344 |
| 214 | Ga0123357_10023969 | 3300009784 | Bacteria | 8208 |
| 215 | Ga0123356_10000554 | 3300010049 | Bacteria | 41448 |
| 216 | Ga0123356_10011330 | 3300010049 | Bacteria | 8699 |
| 217 | Ga0123356_10088824 | 3300010049 | Bacteria | 2939 |
| 218 | Ga0123353_10291537 | 3300010167 | Bacteria | 2498 |
| 219 | Ga0466705_228041 | 3300042612 | Bacteria | 9385 |
| 220 | Ga0466705_296259 | 3300042612 | Bacteria | 2370 |
| 221 | Ga0466716_410411 | 3300042605 | Bacteria | 3596 |
| 222 | Ga0466719_126770 | 3300042606 | Bacteria | 8851 |
| 223 | Ga0466719_301996 | 3300042606 | Bacteria | 12195 |
| 224 | Ga0466722_214842 | 3300042609 | Bacteria | 6410 |
| 225 | AustNasuHG_c1003398 | 3300000089 | Bacteria | 5749 |
| 226 | JGI24698J34947_10016502 | 3300002449 | Bacteria | 4008 |
| 227 | JGI24698J34947_10029936 | 3300002449 | Bacteria | 2874 |
| 228 | JGI24695J34938_10000080 | 3300002450 | Bacteria | 82616 |
| 229 | JGI24695J34938_10000442 | 3300002450 | Bacteria | 40061 |
| 230 | JGI24695J34938_10002312 | 3300002450 | Bacteria | 14667 |
| 231 | JGI24695J34938_10018712 | 3300002450 | Bacteria | 3452 |
| 232 | JGI24702J35022_10002500 | 3300002462 | Bacteria | 11224 |
| 233 | Ga0072941_1158910 | 3300005201 | Bacteria | 4018 |
| 234 | Ga0264413_102462 | 3300024493 | Bacteria | 36892 |
| 235 | Ga0264413_118608 | 3300024493 | Bacteria | 6120 |
| 236 | Ga0466693_219252 | 3300042592 | Bacteria | 11724 |
| 237 | Ga0466694_006451 | 3300042594 | Bacteria | 18798 |
| 238 | Ga0466694_017850 | 3300042594 | Bacteria | 32795 |
| 239 | Ga0466694_124512 | 3300042594 | Bacteria | 16958 |
| 240 | Ga0466694_164873 | 3300042594 | Bacteria | 42610 |
| 241 | Ga0466696_182025 | 3300042596 | Bacteria | 4244 |
| 242 | Ga0466699_016273 | 3300042597 | Bacteria | 38876 |
| 243 | Ga0466712_067284 | 3300042614 | Bacteria | 2215 |
| 244 | Ga0466711_173251 | 3300042615 | Bacteria | 3534 |
| 245 | Ga0466715_119905 | 3300042616 | Unclassified | 11536 |
| 246 | Ga0466718_118554 | 3300042617 | Bacteria | 3097 |
| 247 | Ga0466704_579526 | 3300042643 | Bacteria | 2442 |
| 248 | Ga0466709_337580 | 3300042648 | Bacteria | 6644 |
| 249 | Ga0466732_231902 | 3300042656 | Bacteria | 5151 |
| 250 | Ga0466719_324180 | 3300042606 | Bacteria | 4279 |
| 251 | Ga0466719_378374 | 3300042606 | Bacteria | 2143 |
| 252 | Ga0466720_079348 | 3300042607 | Bacteria | 3608 |
| 253 | Ga0466720_144118 | 3300042607 | Bacteria | 25436 |
| 254 | JGI24698J34947_10025196 | 3300002449 | Bacteria | 3168 |
| 255 | JGI24695J34938_10000072 | 3300002450 | Bacteria | 85833 |
| 256 | JGI24695J34938_10000081 | 3300002450 | Bacteria | 82371 |
| 257 | JGI24695J34938_10000595 | 3300002450 | Bacteria | 34813 |
| 258 | JGI24695J34938_10001772 | 3300002450 | Bacteria | 17817 |
| 259 | JGI24695J34938_10001832 | 3300002450 | Bacteria | 17374 |
| 260 | JGI24695J34938_10002256 | 3300002450 | Bacteria | 14911 |
| 261 | JGI24695J34938_10007387 | 3300002450 | Bacteria | 6439 |
| 262 | JGI24695J34938_10022929 | 3300002450 | Bacteria | 3018 |
| 263 | JGI24702J35022_10002330 | 3300002462 | Bacteria | 11615 |
| 264 | Ga0072940_1050513 | 3300005200 | Bacteria | 9126 |
| 265 | Ga0264413_111425 | 3300024493 | Bacteria | 62805 |
| 266 | Ga0466690_064030 | 3300042590 | Bacteria | 2630 |
| 267 | Ga0466692_159060 | 3300042591 | Bacteria | 7070 |
| 268 | Ga0466693_293912 | 3300042592 | Bacteria | 55262 |
| 269 | Ga0466691_109089 | 3300042593 | Bacteria | 5790 |
| 270 | Ga0466695_287473 | 3300042595 | Bacteria | 18164 |
| 271 | Ga0466699_369078 | 3300042597 | Bacteria | 14583 |
| 272 | Ga0466712_002757 | 3300042614 | Bacteria | 12771 |
| 273 | Ga0466712_055787 | 3300042614 | Bacteria | 25522 |
| 274 | Ga0466712_093993 | 3300042614 | Bacteria | 15046 |
| 275 | Ga0466715_047371 | 3300042616 | Bacteria | 26169 |
| 276 | Ga0466715_085390 | 3300042616 | Bacteria | 2209 |
| 277 | Ga0466718_054285 | 3300042617 | Archaea | 3704 |
| 278 | Ga0466723_210192 | 3300042618 | Unclassified | 5041 |
| 279 | Ga0466726_159305 | 3300042619 | Bacteria | 11235 |
| 280 | Ga0466728_382045 | 3300042620 | Bacteria | 5064 |
| 281 | Ga0466729_062401 | 3300042621 | Bacteria | 1752 |
| 282 | Ga0466703_166664 | 3300042636 | Bacteria | 9119 |
| 283 | Ga0123355_10042857 | 3300009826 | Bacteria | 7366 |
| 284 | Ga0123356_10004995 | 3300010049 | Bacteria | 13603 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.