Protein Family IF07899
Metagenome
Isolate
184
Members
44
Samples
175
Scaffolds
191.96
Avg Length
Representative Sequence
- ID
- 3300042617|Ga0466718_041060|Ga0466718_041060_344_1024
- Length
- 226 aa
- Sequence
- LYAGIFAGHRRNVRDLPCCIIAEKPVLLNSATGGIMGALPQEQEEHFFTYADYKEWELDEGERFELINGEAYAMSGPNTRHQEILMALSSQFYNYLQGKPCKVYPAPFDVRLFYEEDESDDTVVQPDITVICDEKKRGYEGCRGAPDLVIEILSPSNTAIEMERKLKLYQEAGVREYWIVDPENNGVTVYRFQEGAIPTYLYKSADTVPVGIFPDLNIALEQVFAG
Sample Types
Isolate
4.9%
Metagenome
95.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
47.6%
Kalotermitidae
23.8%
Unclassified
19.0%
Rhinotermitidae
4.8%
Termopsidae
4.8%
Taxonomy
Archaea
1
Bacteria
172
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 2 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 3 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 4 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 5 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 6 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 7 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 8 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 9 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 10 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 11 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 14 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 15 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 16 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 17 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 18 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 19 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 20 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 21 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 22 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 23 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 24 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 25 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 26 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 27 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 28 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 29 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 30 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 31 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 32 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 33 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 34 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 35 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 36 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 37 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 38 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 39 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 40 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 41 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 42 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 43 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 44 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466712_032498 | 3300042614 | Bacteria | 11962 |
| 2 | Ga0466723_101599 | 3300042618 | Bacteria | 4201 |
| 3 | Ga0123357_10197814 | 3300009784 | Bacteria | 2296 |
| 4 | Ga0123354_10203676 | 3300010882 | Bacteria | 2165 |
| 5 | Ga0466700_448216 | 3300042600 | Bacteria | 1030 |
| 6 | Ga0466720_045529 | 3300042607 | Bacteria | 15525 |
| 7 | Ga0466720_160881 | 3300042607 | Bacteria | 1141 |
| 8 | Ga0466720_175934 | 3300042607 | Bacteria | 2570 |
| 9 | Ga0466704_205115 | 3300042643 | Bacteria | 1549 |
| 10 | Ga0466704_561911 | 3300042643 | Unclassified | 1264 |
| 11 | AustNasuHG_c1006475 | 3300000089 | Bacteria | 4175 |
| 12 | JGI24698J34947_10020402 | 3300002449 | Unclassified | 3569 |
| 13 | JGI24698J34947_10028860 | 3300002449 | Bacteria | 2936 |
| 14 | JGI24698J34947_10028941 | 3300002449 | Bacteria | 2932 |
| 15 | JGI24698J34947_10033904 | 3300002449 | Unclassified | 2675 |
| 16 | JGI24698J34947_10036586 | 3300002449 | Bacteria | 2555 |
| 17 | JGI24695J34938_10013135 | 3300002450 | Archaea | 4360 |
| 18 | JGI24695J34938_10037673 | 3300002450 | Bacteria | 2195 |
| 19 | Ga0466691_068529 | 3300042593 | Bacteria | 14153 |
| 20 | Ga0466699_346949 | 3300042597 | Bacteria | 1009 |
| 21 | Ga0466699_442898 | 3300042597 | Bacteria | 15300 |
| 22 | Ga0466732_112324 | 3300042656 | Bacteria | 4800 |
| 23 | Ga0466732_127479 | 3300042656 | Bacteria | 1299 |
| 24 | Ga0466732_178403 | 3300042656 | Bacteria | 1790 |
| 25 | Ga0466732_340844 | 3300042656 | Bacteria | 10833 |
| 26 | Ga0466732_380393 | 3300042656 | Bacteria | 3055 |
| 27 | Ga0466712_012068 | 3300042614 | Bacteria | 14829 |
| 28 | Ga0466712_149032 | 3300042614 | Bacteria | 2774 |
| 29 | Ga0466711_246869 | 3300042615 | Bacteria | 1361 |
| 30 | Ga0123356_11226772 | 3300010049 | Bacteria | 915 |
| 31 | Ga0466716_351657 | 3300042605 | Bacteria | 1083 |
| 32 | Ga0466720_004997 | 3300042607 | Bacteria | 6464 |
| 33 | Ga0466720_064367 | 3300042607 | Bacteria | 2435 |
| 34 | Ga0466720_127056 | 3300042607 | Bacteria | 1056 |
| 35 | Ga0466722_146713 | 3300042609 | Bacteria | 1239 |
| 36 | Ga0466704_432424 | 3300042643 | Bacteria | 4987 |
| 37 | AustNasuHG_c1007720 | 3300000089 | Bacteria | 3817 |
| 38 | JGI24698J34947_10049370 | 3300002449 | Bacteria | 2126 |
| 39 | JGI24698J34947_10059993 | 3300002449 | Bacteria | 1878 |
| 40 | JGI24698J34947_10167626 | 3300002449 | Bacteria | 893 |
| 41 | JGI24699J35502_11060511 | 3300002509 | Unclassified | 1735 |
| 42 | Ga0264413_106929 | 3300024493 | Bacteria | 8029 |
| 43 | Ga0466699_042522 | 3300042597 | Bacteria | 8473 |
| 44 | Ga0466699_362602 | 3300042597 | Bacteria | 2121 |
| 45 | Ga0466705_015452 | 3300042612 | Bacteria | 10462 |
| 46 | Ga0466712_038397 | 3300042614 | Bacteria | 1833 |
| 47 | Ga0466712_298872 | 3300042614 | Unclassified | 1006 |
| 48 | Ga0466718_082949 | 3300042617 | Bacteria | 1101 |
| 49 | Ga0123357_10123683 | 3300009784 | Bacteria | 3249 |
| 50 | Ga0123356_10002661 | 3300010049 | Bacteria | 18991 |
| 51 | Ga0123356_10439306 | 3300010049 | Bacteria | 1451 |
| 52 | Ga0123354_10173989 | 3300010882 | Bacteria | 2490 |
| 53 | Ga0466700_458199 | 3300042600 | Bacteria | 1099 |
| 54 | Ga0466720_103641 | 3300042607 | Bacteria | 8221 |
| 55 | Ga0466708_397530 | 3300042652 | Bacteria | 1559 |
| 56 | AustNasuHG_c1021163 | 3300000089 | Bacteria | 2109 |
| 57 | JGI24698J34947_10015107 | 3300002449 | Bacteria | 4204 |
| 58 | JGI24698J34947_10028311 | 3300002449 | Bacteria | 2967 |
| 59 | Ga0072941_1079076 | 3300005201 | Bacteria | 876 |
| 60 | Ga0466692_044971 | 3300042591 | Bacteria | 6879 |
| 61 | Ga0466694_154753 | 3300042594 | Bacteria | 3188 |
| 62 | Ga0466694_218296 | 3300042594 | Bacteria | 1167 |
| 63 | Ga0466699_216805 | 3300042597 | Bacteria | 1759 |
| 64 | Ga0466732_180341 | 3300042656 | Bacteria | 1220 |
| 65 | Ga0466712_008153 | 3300042614 | Bacteria | 2535 |
| 66 | Ga0466718_041060 | 3300042617 | Bacteria | 3421 |
| 67 | Ga0466726_204036 | 3300042619 | Bacteria | 1175 |
| 68 | Ga0466726_300183 | 3300042619 | Bacteria | 1703 |
| 69 | Ga0466700_357865 | 3300042600 | Bacteria | 1245 |
| 70 | Ga0466719_362242 | 3300042606 | Bacteria | 1134 |
| 71 | Ga0466720_019896 | 3300042607 | Bacteria | 6405 |
| 72 | Ga0466720_094435 | 3300042607 | Bacteria | 70325 |
| 73 | Ga0466720_130067 | 3300042607 | Bacteria | 2402 |
| 74 | Ga0466704_021778 | 3300042643 | Bacteria | 2330 |
| 75 | Ga0466727_241928 | 3300042655 | Bacteria | 1290 |
| 76 | Ga0466727_243717 | 3300042655 | Bacteria | 1479 |
| 77 | AustNasuHG_c1000681 | 3300000089 | Bacteria | 12073 |
| 78 | AustNasuHG_c1008598 | 3300000089 | Bacteria | 3614 |
| 79 | JGI24698J34947_10004558 | 3300002449 | Unclassified | 7550 |
| 80 | JGI24698J34947_10010743 | 3300002449 | Bacteria | 5026 |
| 81 | JGI24698J34947_10034554 | 3300002449 | Bacteria | 2644 |
| 82 | JGI24698J34947_10050397 | 3300002449 | Bacteria | 2100 |
| 83 | JGI24695J34938_10015871 | 3300002450 | Bacteria | 3851 |
| 84 | JGI24695J34938_10029150 | 3300002450 | Bacteria | 2585 |
| 85 | Ga0072940_1163435 | 3300005200 | Bacteria | 1280 |
| 86 | Ga0466690_072620 | 3300042590 | Bacteria | 2873 |
| 87 | Ga0466694_012298 | 3300042594 | Bacteria | 2318 |
| 88 | Ga0466694_094067 | 3300042594 | Bacteria | 1584 |
| 89 | Ga0466699_160214 | 3300042597 | Bacteria | 1169 |
| 90 | Ga0466732_265951 | 3300042656 | Unclassified | 1239 |
| 91 | Ga0466711_167524 | 3300042615 | Bacteria | 4105 |
| 92 | Ga0466718_097840 | 3300042617 | Bacteria | 2291 |
| 93 | Ga0123355_10040034 | 3300009826 | Bacteria | 7629 |
| 94 | Ga0123356_10006683 | 3300010049 | Bacteria | 11617 |
| 95 | Ga0123356_10206132 | 3300010049 | Bacteria | 2010 |
| 96 | Ga0123356_10217951 | 3300010049 | Bacteria | 1963 |
| 97 | Ga0123356_11047208 | 3300010049 | Bacteria | 985 |
| 98 | Ga0466720_001709 | 3300042607 | Bacteria | 6508 |
| 99 | Ga0466720_028290 | 3300042607 | Bacteria | 4278 |
| 100 | Ga0466720_045410 | 3300042607 | Bacteria | 3284 |
| 101 | Ga0466720_177690 | 3300042607 | Bacteria | 1112 |
| 102 | Ga0466702_421756 | 3300042635 | Bacteria | 2190 |
| 103 | JGI24698J34947_10002598 | 3300002449 | Bacteria | 9750 |
| 104 | JGI24698J34947_10021672 | 3300002449 | Bacteria | 3452 |
| 105 | JGI24698J34947_10217754 | 3300002449 | Bacteria | 735 |
| 106 | JGI24698J34947_10220266 | 3300002449 | Bacteria | 728 |
| 107 | JGI24695J34938_10003056 | 3300002450 | Bacteria | 11987 |
| 108 | JGI24695J34938_10092524 | 3300002450 | Bacteria | 1240 |
| 109 | JGI24702J35022_10018750 | 3300002462 | Bacteria | 3771 |
| 110 | Ga0072940_1006204 | 3300005200 | Bacteria | 6613 |
| 111 | Ga0072941_1090418 | 3300005201 | Bacteria | 1335 |
| 112 | Ga0466694_015999 | 3300042594 | Bacteria | 1001 |
| 113 | Ga0466699_184567 | 3300042597 | Bacteria | 1583 |
| 114 | Ga0466699_220474 | 3300042597 | Bacteria | 1546 |
| 115 | Ga0466699_291533 | 3300042597 | Unclassified | 1355 |
| 116 | Ga0466699_363376 | 3300042597 | Bacteria | 11266 |
| 117 | Ga0466732_130135 | 3300042656 | Bacteria | 1482 |
| 118 | Ga0466712_117918 | 3300042614 | Bacteria | 8905 |
| 119 | Ga0466712_272587 | 3300042614 | Bacteria | 9718 |
| 120 | Ga0123357_10044176 | 3300009784 | Bacteria | 6049 |
| 121 | Ga0123357_10120078 | 3300009784 | Bacteria | 3314 |
| 122 | Ga0123356_10057430 | 3300010049 | Bacteria | 3628 |
| 123 | Ga0123356_10285331 | 3300010049 | Bacteria | 1748 |
| 124 | Ga0466700_120673 | 3300042600 | Bacteria | 1647 |
| 125 | Ga0466700_133540 | 3300042600 | Bacteria | 2656 |
| 126 | Ga0466720_052117 | 3300042607 | Bacteria | 26645 |
| 127 | AustNasuHG_c1001148 | 3300000089 | Bacteria | 9534 |
| 128 | JGI24698J34947_10021519 | 3300002449 | Bacteria | 3467 |
| 129 | JGI24698J34947_10041671 | 3300002449 | Unclassified | 2363 |
| 130 | JGI24698J34947_10102610 | 3300002449 | Bacteria | 1282 |
| 131 | JGI24698J34947_10157061 | 3300002449 | Bacteria | 937 |
| 132 | Ga0072941_1018924 | 3300005201 | Bacteria | 8007 |
| 133 | Ga0415639_104321 | 3300038395 | Bacteria | 5719 |
| 134 | Ga0466694_162493 | 3300042594 | Bacteria | 1638 |
| 135 | Ga0466705_194783 | 3300042612 | Bacteria | 1050 |
| 136 | Ga0466732_271748 | 3300042656 | Unclassified | 1708 |
| 137 | Ga0466726_247901 | 3300042619 | Bacteria | 1300 |
| 138 | Ga0123356_10000125 | 3300010049 | Bacteria | 84722 |
| 139 | Ga0123356_10151925 | 3300010049 | Bacteria | 2300 |
| 140 | Ga0466720_064162 | 3300042607 | Bacteria | 9480 |
| 141 | Ga0466720_098265 | 3300042607 | Bacteria | 6085 |
| 142 | Ga0466720_132662 | 3300042607 | Bacteria | 6922 |
| 143 | Ga0466720_166171 | 3300042607 | Bacteria | 2959 |
| 144 | Ga0466702_121295 | 3300042635 | Bacteria | 1128 |
| 145 | Ga0466704_606608 | 3300042643 | Bacteria | 3031 |
| 146 | JGI24698J34947_10010183 | 3300002449 | Bacteria | 5155 |
| 147 | JGI24698J34947_10081193 | 3300002449 | Bacteria | 1521 |
| 148 | JGI24698J34947_10127666 | 3300002449 | Bacteria | 1092 |
| 149 | JGI24698J34947_10165809 | 3300002449 | Unclassified | 900 |
| 150 | Ga0072940_1098963 | 3300005200 | Bacteria | 734 |
| 151 | Ga0072941_1028774 | 3300005201 | Bacteria | 2118 |
| 152 | Ga0074263_115933 | 3300005485 | Bacteria | 875 |
| 153 | Ga0264413_109884 | 3300024493 | Bacteria | 2715 |
| 154 | Ga0466694_157302 | 3300042594 | Bacteria | 23788 |
| 155 | Ga0466699_263796 | 3300042597 | Bacteria | 1633 |
| 156 | Ga0466711_174683 | 3300042615 | Bacteria | 10675 |
| 157 | Ga0466715_346486 | 3300042616 | Bacteria | 1063 |
| 158 | Ga0466718_074068 | 3300042617 | Bacteria | 2060 |
| 159 | Ga0466718_127806 | 3300042617 | Bacteria | 4033 |
| 160 | Ga0466718_127966 | 3300042617 | Bacteria | 1284 |
| 161 | Ga0466726_070624 | 3300042619 | Bacteria | 6662 |
| 162 | Ga0123357_10304446 | 3300009784 | Bacteria | 1603 |
| 163 | Ga0123356_10729893 | 3300010049 | Bacteria | 1160 |
| 164 | Ga0123356_12172267 | 3300010049 | Bacteria | 694 |
| 165 | Ga0466720_085390 | 3300042607 | Bacteria | 10435 |
| 166 | Ga0466720_090577 | 3300042607 | Bacteria | 1818 |
| 167 | Ga0466708_265424 | 3300042652 | Bacteria | 1059 |
| 168 | JGI24698J34947_10025913 | 3300002449 | Bacteria | 3118 |
| 169 | JGI24695J34938_10000986 | 3300002450 | Bacteria | 25876 |
| 170 | JGI24695J34938_10014225 | 3300002450 | Bacteria | 4136 |
| 171 | JGI24695J34938_10288521 | 3300002450 | Bacteria | 706 |
| 172 | Ga0072941_1011759 | 3300005201 | Bacteria | 16412 |
| 173 | Ga0072941_1034242 | 3300005201 | Bacteria | 2681 |
| 174 | Ga0466694_155249 | 3300042594 | Bacteria | 1489 |
| 175 | Ga0466699_389928 | 3300042597 | Bacteria | 1588 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF05685 | Uma2 | Putative restriction endonuclease | 51 | 220 | 0.91 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.