Protein Family IF07889
Metagenome
Isolate
146
Members
53
Samples
144
Scaffolds
135.17
Avg Length
Representative Sequence
- ID
- 3300042617|Ga0466718_036071|Ga0466718_036071_5031_5501
- Length
- 156 aa
- Sequence
- VKLVIDTNLWISYLISERLDDLEDLCLDRSISIIYCDELIEEIIKVANTPKIRKRGVEDQNVFDLVELIKLNGIKTEIKNVSGYAIRDSKDAYLLALADIVKADFLLSGDRDLLVLRLHNQTKIISYSKFMAKYKNFLWRLKRLINSFLKSCIYPA
Sample Types
Isolate
1.4%
Metagenome
98.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
56.9%
Kalotermitidae
19.6%
Termopsidae
7.8%
Unclassified
7.8%
Passalidae
5.9%
Rhinotermitidae
2.0%
Taxonomy
Archaea
2
Bacteria
130
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 9 | 2740892545 | Fibrobacteria bacterium GUT31 IN01_31 | Isolate | Unclassified |
| 10 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 11 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 12 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 13 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 14 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 15 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 16 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 17 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 18 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 19 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 20 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 21 | 2778260941 | Unclassified Fibrobacteres Th196P3bin8 | Isolate | Unclassified |
| 22 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 23 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 24 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 25 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 26 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 27 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 28 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 29 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 30 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 31 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 32 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 33 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 34 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 35 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 36 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 37 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 38 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 39 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 40 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 41 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 42 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 43 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 44 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 45 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 46 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 47 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 48 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 49 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 50 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 51 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 52 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 53 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_086638 | 3300042611 | Bacteria | 1476 |
| 2 | Ga0466712_207777 | 3300042614 | Bacteria | 1572 |
| 3 | Ga0466717_001418 | 3300042604 | Bacteria | 1113 |
| 4 | Ga0466717_250656 | 3300042604 | Bacteria | 3896 |
| 5 | Ga0466719_561076 | 3300042606 | Bacteria | 1183 |
| 6 | Ga0466735_131705 | 3300042624 | Bacteria | 1518 |
| 7 | Ga0466703_002642 | 3300042636 | Bacteria | 6007 |
| 8 | Ga0466709_125791 | 3300042648 | Bacteria | 3380 |
| 9 | Ga0123356_10569452 | 3300010049 | Bacteria | 1295 |
| 10 | Ga0123354_10336547 | 3300010882 | Bacteria | 1367 |
| 11 | Ga0123354_10780245 | 3300010882 | Bacteria | 648 |
| 12 | IMNBL1DRAFT_c0001726 | 3300000062 | Bacteria | 16054 |
| 13 | JGI24698J34947_10036172 | 3300002449 | Bacteria | 2572 |
| 14 | JGI24702J35022_10029826 | 3300002462 | Bacteria | 2926 |
| 15 | JGI24702J35022_10586380 | 3300002462 | Bacteria | 689 |
| 16 | Ga0072941_1455792 | 3300005201 | Bacteria | 1293 |
| 17 | Ga0466691_094706 | 3300042593 | Bacteria | 2204 |
| 18 | Ga0466694_032735 | 3300042594 | Bacteria | 1751 |
| 19 | Ga0466701_020347 | 3300042598 | Bacteria | 7259 |
| 20 | Ga0466734_154156 | 3300042623 | Bacteria | 1484 |
| 21 | Ga0466735_143734 | 3300042624 | Bacteria | 3043 |
| 22 | Ga0466727_307508 | 3300042655 | Bacteria | 1246 |
| 23 | Ga0123357_10283302 | 3300009784 | Bacteria | 1707 |
| 24 | Ga0123356_10155601 | 3300010049 | Bacteria | 2276 |
| 25 | Ga0123353_10436624 | 3300010167 | Unclassified | 1933 |
| 26 | Ga0123353_13185342 | 3300010167 | Bacteria | 526 |
| 27 | IMNBL1DRAFT_c0051537 | 3300000062 | Bacteria | 1296 |
| 28 | JGI24702J35022_10093524 | 3300002462 | Unclassified | 1639 |
| 29 | JGI24702J35022_10351087 | 3300002462 | Bacteria | 882 |
| 30 | JGI24705J35276_11936206 | 3300002504 | Bacteria | 781 |
| 31 | JGI24696J40584_12843410 | 3300002834 | Bacteria | 961 |
| 32 | Ga0068302_10103457 | 3300005071 | Unclassified | 1077 |
| 33 | Ga0466733_094214 | 3300042659 | Bacteria | 13671 |
| 34 | Ga0466713_043314 | 3300042602 | Bacteria | 1788 |
| 35 | Ga0466713_078638 | 3300042602 | Bacteria | 24003 |
| 36 | Ga0466714_143659 | 3300042603 | Bacteria | 5966 |
| 37 | Ga0466731_122536 | 3300042622 | Bacteria | 1309 |
| 38 | Ga0466704_268965 | 3300042643 | Bacteria | 2266 |
| 39 | Ga0123356_10238643 | 3300010049 | Bacteria | 1887 |
| 40 | Ga0123356_10654320 | 3300010049 | Bacteria | 1218 |
| 41 | Ga0123356_10776653 | 3300010049 | Bacteria | 1129 |
| 42 | Ga0123356_11299568 | 3300010049 | Bacteria | 891 |
| 43 | Ga0123356_12552512 | 3300010049 | Bacteria | 640 |
| 44 | Ga0123353_11564261 | 3300010167 | Bacteria | 835 |
| 45 | Ga0123354_10103648 | 3300010882 | Bacteria | 3824 |
| 46 | Ga0123354_10168761 | 3300010882 | Bacteria | 2558 |
| 47 | Ga0123354_10464636 | 3300010882 | Bacteria | 1013 |
| 48 | IMNBL1DRAFT_c0094352 | 3300000062 | Bacteria | 815 |
| 49 | AustNasuHG_c1030873 | 3300000089 | Bacteria | 1529 |
| 50 | JGI24705J35276_12202228 | 3300002504 | Bacteria | 1633 |
| 51 | Ga0466705_018636 | 3300042612 | Bacteria | 1042 |
| 52 | Ga0466732_024502 | 3300042656 | Unclassified | 2460 |
| 53 | Ga0466729_045591 | 3300042621 | Bacteria | 4853 |
| 54 | Ga0466707_295295 | 3300042601 | Bacteria | 4713 |
| 55 | Ga0466719_303849 | 3300042606 | Bacteria | 1090 |
| 56 | Ga0466720_177914 | 3300042607 | Bacteria | 15572 |
| 57 | Ga0466731_065802 | 3300042622 | Bacteria | 13521 |
| 58 | Ga0466704_098115 | 3300042643 | Bacteria | 5423 |
| 59 | Ga0466704_582691 | 3300042643 | Bacteria | 17469 |
| 60 | Ga0466725_364531 | 3300042654 | Unclassified | 1163 |
| 61 | Ga0123356_10368944 | 3300010049 | Bacteria | 1565 |
| 62 | AustNasuHG_c1010300 | 3300000089 | Unclassified | 3259 |
| 63 | JGI24698J34947_10003846 | 3300002449 | Bacteria | 8166 |
| 64 | JGI24699J35502_10839248 | 3300002509 | Bacteria | 936 |
| 65 | Ga0072940_1186727 | 3300005200 | Bacteria | 648 |
| 66 | Ga0466697_104938 | 3300042611 | Bacteria | 1278 |
| 67 | Ga0466697_174206 | 3300042611 | Unclassified | 1892 |
| 68 | Ga0466697_180717 | 3300042611 | Unclassified | 1496 |
| 69 | Ga0264413_148741 | 3300024493 | Bacteria | 1576 |
| 70 | Ga0466712_023404 | 3300042614 | Bacteria | 1153 |
| 71 | Ga0466711_043357 | 3300042615 | Bacteria | 1878 |
| 72 | Ga0466720_197869 | 3300042607 | Bacteria | 20308 |
| 73 | Ga0466698_022673 | 3300042610 | Archaea | 2002 |
| 74 | Ga0466704_020708 | 3300042643 | Bacteria | 5084 |
| 75 | Ga0466724_15818 | 3300042649 | Bacteria | 1017 |
| 76 | Ga0466725_406897 | 3300042654 | Bacteria | 2891 |
| 77 | Ga0072940_1023271 | 3300005200 | Bacteria | 12786 |
| 78 | Ga0072940_1230846 | 3300005200 | Bacteria | 1023 |
| 79 | Ga0072941_1003853 | 3300005201 | Bacteria | 7821 |
| 80 | Ga0072941_1711633 | 3300005201 | Bacteria | 792 |
| 81 | Ga0074263_118082 | 3300005485 | Unclassified | 1432 |
| 82 | Ga0466705_105560 | 3300042612 | Bacteria | 3440 |
| 83 | Ga0466705_166113 | 3300042612 | Bacteria | 2577 |
| 84 | Ga0466699_170876 | 3300042597 | Bacteria | 1249 |
| 85 | Ga0466715_462944 | 3300042616 | Bacteria | 1108 |
| 86 | Ga0466726_174241 | 3300042619 | Bacteria | 1366 |
| 87 | Ga0466728_014489 | 3300042620 | Bacteria | 1056 |
| 88 | Ga0466728_296402 | 3300042620 | Bacteria | 15807 |
| 89 | Ga0466729_194589 | 3300042621 | Bacteria | 2764 |
| 90 | Ga0466707_169831 | 3300042601 | Bacteria | 1029 |
| 91 | Ga0466703_009210 | 3300042636 | Bacteria | 2686 |
| 92 | Ga0466725_231041 | 3300042654 | Bacteria | 1186 |
| 93 | Ga0123357_10440370 | 3300009784 | Bacteria | 1141 |
| 94 | Ga0123356_10091323 | 3300010049 | Bacteria | 2902 |
| 95 | Ga0123356_10108816 | 3300010049 | Bacteria | 2673 |
| 96 | Ga0123356_13530104 | 3300010049 | Bacteria | 542 |
| 97 | Ga0123353_10008993 | 3300010167 | Bacteria | 13723 |
| 98 | Ga0123353_10348082 | 3300010167 | Bacteria | 2234 |
| 99 | 2227094710 | 2225789004 | Bacteria | 9724 |
| 100 | IMNBGM34_c000338 | 3300000036 | Bacteria | 13507 |
| 101 | JGI24705J35276_12155705 | 3300002504 | Bacteria | 1205 |
| 102 | JGI24696J40584_12605781 | 3300002834 | Bacteria | 660 |
| 103 | JGI24696J40584_12800576 | 3300002834 | Bacteria | 869 |
| 104 | Ga0072940_1048322 | 3300005200 | Unclassified | 1373 |
| 105 | Ga0415639_267824 | 3300038395 | Unclassified | 1027 |
| 106 | Ga0466718_012861 | 3300042617 | Bacteria | 1176 |
| 107 | Ga0466726_423232 | 3300042619 | Bacteria | 1225 |
| 108 | Ga0466708_054750 | 3300042652 | Bacteria | 1206 |
| 109 | Ga0123357_10079885 | 3300009784 | Bacteria | 4304 |
| 110 | Ga0123353_10737310 | 3300010167 | Bacteria | 1374 |
| 111 | Ga0123354_10025846 | 3300010882 | Bacteria | 9257 |
| 112 | Ga0123354_10415329 | 3300010882 | Bacteria | 1124 |
| 113 | 2227632136 | 2225789004 | Bacteria | 2115 |
| 114 | IMNBL1DRAFT_c0013479 | 3300000062 | Bacteria | 3663 |
| 115 | JGI24698J34947_10072711 | 3300002449 | Unclassified | 1644 |
| 116 | JGI24702J35022_10051086 | 3300002462 | Bacteria | 2203 |
| 117 | JGI24702J35022_10126951 | 3300002462 | Bacteria | 1413 |
| 118 | JGI24702J35022_10158895 | 3300002462 | Bacteria | 1272 |
| 119 | JGI24702J35022_10185520 | 3300002462 | Bacteria | 1184 |
| 120 | JGI24705J35276_12214584 | 3300002504 | Bacteria | 1967 |
| 121 | JGI24699J35502_11131650 | 3300002509 | Bacteria | 5894 |
| 122 | JGI24699J35502_11133985 | 3300002509 | Bacteria | 22789 |
| 123 | Ga0072940_1132000 | 3300005200 | Bacteria | 3430 |
| 124 | Ga0466732_278272 | 3300042656 | Archaea | 1583 |
| 125 | Ga0466694_065929 | 3300042594 | Bacteria | 2154 |
| 126 | Ga0466712_155764 | 3300042614 | Bacteria | 1820 |
| 127 | Ga0466712_203007 | 3300042614 | Unclassified | 3312 |
| 128 | Ga0466718_036071 | 3300042617 | Bacteria | 9026 |
| 129 | Ga0466719_233232 | 3300042606 | Bacteria | 1186 |
| 130 | Ga0466734_157975 | 3300042623 | Bacteria | 2409 |
| 131 | Ga0466703_410027 | 3300042636 | Bacteria | 1002 |
| 132 | Ga0466709_330746 | 3300042648 | Bacteria | 30118 |
| 133 | Ga0123357_10015749 | 3300009784 | Bacteria | 9917 |
| 134 | Ga0123356_11261273 | 3300010049 | Bacteria | 903 |
| 135 | Ga0123356_12015110 | 3300010049 | Bacteria | 720 |
| 136 | Ga0123353_10040020 | 3300010167 | Unclassified | 7389 |
| 137 | Ga0123354_10205513 | 3300010882 | Bacteria | 2148 |
| 138 | JGI24698J34947_10002469 | 3300002449 | Bacteria | 9983 |
| 139 | JGI24698J34947_10049408 | 3300002449 | Bacteria | 2125 |
| 140 | JGI24698J34947_10139821 | 3300002449 | Bacteria | 1022 |
| 141 | JGI24702J35022_10086221 | 3300002462 | Bacteria | 1705 |
| 142 | JGI24702J35022_10245554 | 3300002462 | Bacteria | 1040 |
| 143 | JGI24705J35276_11384207 | 3300002504 | Bacteria | 523 |
| 144 | JGI24696J40584_12737087 | 3300002834 | Bacteria | 777 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042612 | Ga0466705_166113 | Ga0466705_166113_891_1244 | 117 |
| 2 | 3300010049 | Ga0123356_13530104 | Ga0123356_135301041 | 118 |
| 3 | 3300042604 | Ga0466717_001418 | Ga0466717_001418_70_480 | 119 |
| 4 | 3300042606 | Ga0466719_233232 | Ga0466719_233232_637_996 | 119 |
| 5 | 3300042649 | Ga0466724_15818 | Ga0466724_15818_307_720 | 119 |
| 6 | 3300002504 | JGI24705J35276_12202228 | JGI24705J35276_122022282 | 120 |
| 7 | 3300010882 | Ga0123354_10415329 | Ga0123354_104153292 | 120 |
| 8 | 3300042622 | Ga0466731_122536 | Ga0466731_122536_494_910 | 120 |
| 9 | 3300002509 | JGI24699J35502_11133985 | JGI24699J35502_111339856 | 121 |
| 10 | 3300010049 | Ga0123356_10776653 | Ga0123356_107766533 | 121 |
| 11 | 3300042603 | Ga0466714_143659 | Ga0466714_143659_4096_4461 | 121 |
| 12 | 3300002462 | JGI24702J35022_10093524 | JGI24702J35022_100935243 | 122 |
| 13 | 3300002462 | JGI24702J35022_10185520 | JGI24702J35022_101855201 | 122 |
| 14 | 3300002834 | JGI24696J40584_12843410 | JGI24696J40584_128434102 | 122 |
| 15 | 3300010167 | Ga0123353_10436624 | Ga0123353_104366244 | 122 |
| 16 | 3300010882 | Ga0123354_10336547 | Ga0123354_103365474 | 122 |
| 17 | 3300038395 | Ga0415639_267824 | Ga0415639_267824_212_631 | 122 |
| 18 | 3300042606 | Ga0466719_303849 | Ga0466719_303849_69_491 | 122 |
| 19 | 3300042611 | Ga0466697_104938 | Ga0466697_104938_467_886 | 122 |
| 20 | 3300042621 | Ga0466729_045591 | Ga0466729_045591_950_1369 | 122 |
| 21 | 3300002462 | JGI24702J35022_10586380 | JGI24702J35022_105863801 | 123 |
| 22 | 3300002504 | JGI24705J35276_12214584 | JGI24705J35276_122145843 | 123 |
| 23 | 3300010049 | Ga0123356_10108816 | Ga0123356_101088162 | 123 |
| 24 | 3300010049 | Ga0123356_11299568 | Ga0123356_112995682 | 123 |
| 25 | 3300010882 | Ga0123354_10205513 | Ga0123354_102055131 | 124 |
| 26 | 3300042610 | Ga0466698_022673 | Ga0466698_022673_141_554 | 124 |
| 27 | 3300042623 | Ga0466734_154156 | Ga0466734_154156_859_1278 | 124 |
| 28 | 3300002504 | JGI24705J35276_11936206 | JGI24705J35276_119362062 | 125 |
| 29 | 3300010882 | Ga0123354_10025846 | Ga0123354_100258463 | 125 |
| 30 | 3300042611 | Ga0466697_180717 | Ga0466697_180717_862_1290 | 125 |
| 31 | 3300009784 | Ga0123357_10079885 | Ga0123357_100798854 | 126 |
| 32 | 3300010049 | Ga0123356_12015110 | Ga0123356_120151102 | 126 |
| 33 | 3300042654 | Ga0466725_231041 | Ga0466725_231041_556_969 | 126 |
| 34 | 3300000062 | IMNBL1DRAFT_c0051537 | IMNBL1DRAFT_00515373 | 128 |
| 35 | 3300010167 | Ga0123353_10348082 | Ga0123353_103480823 | 128 |
| 36 | 3300042619 | Ga0466726_174241 | Ga0466726_174241_508_936 | 128 |
| 37 | 3300009784 | Ga0123357_10440370 | Ga0123357_104403703 | 129 |
| 38 | 3300042615 | Ga0466711_043357 | Ga0466711_043357_1038_1463 | 129 |
| 39 | 3300002834 | JGI24696J40584_12737087 | JGI24696J40584_127370871 | 130 |
| 40 | 3300042611 | Ga0466697_174206 | Ga0466697_174206_354_782 | 133 |
| 41 | 3300042593 | Ga0466691_094706 | Ga0466691_094706_1066_1470 | 134 |
| 42 | 3300042594 | Ga0466694_032735 | Ga0466694_032735_648_1052 | 134 |
| 43 | 3300042601 | Ga0466707_169831 | Ga0466707_169831_395_823 | 134 |
| 44 | 3300042606 | Ga0466719_561076 | Ga0466719_561076_671_1075 | 134 |
| 45 | 3300042612 | Ga0466705_018636 | Ga0466705_018636_173_577 | 134 |
| 46 | 3300042616 | Ga0466715_462944 | Ga0466715_462944_187_591 | 134 |
| 47 | 3300042620 | Ga0466728_014489 | Ga0466728_014489_435_839 | 134 |
| 48 | 3300042620 | Ga0466728_296402 | Ga0466728_296402_3034_3438 | 134 |
| 49 | 3300042636 | Ga0466703_002642 | Ga0466703_002642_502_906 | 134 |
| 50 | 3300042643 | Ga0466704_582691 | Ga0466704_582691_5899_6303 | 134 |
| 51 | 3300042648 | Ga0466709_125791 | Ga0466709_125791_1860_2264 | 134 |
| 52 | 3300042648 | Ga0466709_330746 | Ga0466709_330746_21957_22391 | 134 |
| 53 | 3300042652 | Ga0466708_054750 | Ga0466708_054750_307_711 | 134 |
| 54 | 3300042643 | Ga0466704_020708 | Ga0466704_020708_1759_2166 | 135 |
| 55 | 2225789004 | 2227632136 | 2228216835 | 136 |
| 56 | 3300002449 | JGI24698J34947_10036172 | JGI24698J34947_100361726 | 136 |
| 57 | 3300002449 | JGI24698J34947_10139821 | JGI24698J34947_101398213 | 136 |
| 58 | 3300002462 | JGI24702J35022_10086221 | JGI24702J35022_100862212 | 136 |
| 59 | 3300002462 | JGI24702J35022_10158895 | JGI24702J35022_101588952 | 136 |
| 60 | 3300002504 | JGI24705J35276_11384207 | JGI24705J35276_113842071 | 136 |
| 61 | 3300005200 | Ga0072940_1048322 | Ga0072940_10483222 | 136 |
| 62 | 3300010049 | Ga0123356_10654320 | Ga0123356_106543203 | 136 |
| 63 | 3300010049 | Ga0123356_11261273 | Ga0123356_112612732 | 136 |
| 64 | 3300010167 | Ga0123353_10008993 | Ga0123353_1000899310 | 136 |
| 65 | 3300010167 | Ga0123353_10040020 | Ga0123353_100400202 | 136 |
| 66 | 3300010167 | Ga0123353_10737310 | Ga0123353_107373102 | 136 |
| 67 | 3300010167 | Ga0123353_11564261 | Ga0123353_115642612 | 136 |
| 68 | 3300010882 | Ga0123354_10780245 | Ga0123354_107802452 | 136 |
| 69 | 3300024493 | Ga0264413_148741 | Ga0264413_1487413 | 136 |
| 70 | 3300042602 | Ga0466713_043314 | Ga0466713_043314_599_1009 | 136 |
| 71 | 3300000062 | IMNBL1DRAFT_c0094352 | IMNBL1DRAFT_00943522 | 137 |
| 72 | 3300005200 | Ga0072940_1132000 | Ga0072940_11320002 | 137 |
| 73 | 3300005485 | Ga0074263_118082 | Ga0074263_1180823 | 137 |
| 74 | 3300010049 | Ga0123356_10155601 | Ga0123356_101556015 | 137 |
| 75 | 3300010049 | Ga0123356_12552512 | Ga0123356_125525122 | 137 |
| 76 | 3300042594 | Ga0466694_065929 | Ga0466694_065929_1524_1937 | 137 |
| 77 | 3300042601 | Ga0466707_295295 | Ga0466707_295295_2086_2499 | 137 |
| 78 | 3300042604 | Ga0466717_250656 | Ga0466717_250656_2542_2955 | 137 |
| 79 | 3300042614 | Ga0466712_155764 | Ga0466712_155764_1032_1445 | 137 |
| 80 | 3300042614 | Ga0466712_207777 | Ga0466712_207777_742_1155 | 137 |
| 81 | 3300042636 | Ga0466703_009210 | Ga0466703_009210_2079_2492 | 137 |
| 82 | 3300042643 | Ga0466704_098115 | Ga0466704_098115_3329_3742 | 137 |
| 83 | 3300042643 | Ga0466704_268965 | Ga0466704_268965_1316_1729 | 137 |
| 84 | 3300000036 | IMNBGM34_c000338 | IMNBGM34_0003383 | 138 |
| 85 | 3300002449 | JGI24698J34947_10072711 | JGI24698J34947_100727112 | 138 |
| 86 | 3300002462 | JGI24702J35022_10051086 | JGI24702J35022_100510865 | 138 |
| 87 | 3300042623 | Ga0466734_157975 | Ga0466734_157975_1751_2167 | 138 |
| 88 | 3300042636 | Ga0466703_410027 | Ga0466703_410027_374_790 | 138 |
| 89 | 3300042655 | Ga0466727_307508 | Ga0466727_307508_326_742 | 138 |
| 90 | 2225789004 | 2227094710 | 2227475435 | 139 |
| 91 | 3300002449 | JGI24698J34947_10002469 | JGI24698J34947_100024699 | 139 |
| 92 | 3300002462 | JGI24702J35022_10126951 | JGI24702J35022_101269512 | 139 |
| 93 | 3300002509 | JGI24699J35502_11131650 | JGI24699J35502_111316502 | 139 |
| 94 | 3300005201 | Ga0072941_1003853 | Ga0072941_10038531 | 139 |
| 95 | 3300005201 | Ga0072941_1455792 | Ga0072941_14557923 | 139 |
| 96 | 3300010167 | Ga0123353_13185342 | Ga0123353_131853422 | 139 |
| 97 | 3300042607 | Ga0466720_197869 | Ga0466720_197869_17443_17862 | 139 |
| 98 | 3300042612 | Ga0466705_105560 | Ga0466705_105560_758_1177 | 139 |
| 99 | 3300042621 | Ga0466729_194589 | Ga0466729_194589_1804_2223 | 139 |
| 100 | 3300042622 | Ga0466731_065802 | Ga0466731_065802_5562_6014 | 139 |
| 101 | 3300042624 | Ga0466735_131705 | Ga0466735_131705_787_1206 | 139 |
| 102 | 3300042624 | Ga0466735_143734 | Ga0466735_143734_329_748 | 139 |
| 103 | 3300042654 | Ga0466725_364531 | Ga0466725_364531_607_1026 | 139 |
| 104 | 3300042659 | Ga0466733_094214 | Ga0466733_094214_1137_1556 | 139 |
| 105 | 3300000062 | IMNBL1DRAFT_c0013479 | IMNBL1DRAFT_00134793 | 140 |
| 106 | 3300002449 | JGI24698J34947_10049408 | JGI24698J34947_100494082 | 140 |
| 107 | 3300002462 | JGI24702J35022_10245554 | JGI24702J35022_102455541 | 140 |
| 108 | 3300002462 | JGI24702J35022_10351087 | JGI24702J35022_103510871 | 140 |
| 109 | 3300002834 | JGI24696J40584_12800576 | JGI24696J40584_128005761 | 140 |
| 110 | 3300005200 | Ga0072940_1186727 | Ga0072940_11867272 | 140 |
| 111 | 3300005201 | Ga0072941_1711633 | Ga0072941_17116331 | 140 |
| 112 | 3300010049 | Ga0123356_10091323 | Ga0123356_100913234 | 140 |
| 113 | 3300010882 | Ga0123354_10464636 | Ga0123354_104646362 | 140 |
| 114 | 3300042607 | Ga0466720_177914 | Ga0466720_177914_2338_2760 | 140 |
| 115 | 3300042617 | Ga0466718_012861 | Ga0466718_012861_524_946 | 140 |
| 116 | 3300042619 | Ga0466726_423232 | Ga0466726_423232_370_792 | 140 |
| 117 | 3300010049 | Ga0123356_10238643 | Ga0123356_102386433 | 141 |
| 118 | 3300010049 | Ga0123356_10368944 | Ga0123356_103689442 | 141 |
| 119 | 3300010049 | Ga0123356_10569452 | Ga0123356_105694522 | 141 |
| 120 | 3300010882 | Ga0123354_10103648 | Ga0123354_101036482 | 141 |
| 121 | 3300042602 | Ga0466713_078638 | Ga0466713_078638_1760_2185 | 141 |
| 122 | 3300042654 | Ga0466725_406897 | Ga0466725_406897_542_967 | 141 |
| 123 | 3300002462 | JGI24702J35022_10029826 | JGI24702J35022_100298264 | 142 |
| 124 | 3300002509 | JGI24699J35502_10839248 | JGI24699J35502_108392482 | 142 |
| 125 | 3300002834 | JGI24696J40584_12605781 | JGI24696J40584_126057812 | 142 |
| 126 | 3300009784 | Ga0123357_10015749 | Ga0123357_100157496 | 142 |
| 127 | 3300042611 | Ga0466697_086638 | Ga0466697_086638_629_1057 | 142 |
| 128 | 3300042656 | Ga0466732_278272 | Ga0466732_278272_1069_1497 | 142 |
| 129 | 3300009784 | Ga0123357_10283302 | Ga0123357_102833021 | 143 |
| 130 | 3300010882 | Ga0123354_10168761 | Ga0123354_101687613 | 143 |
| 131 | 3300042598 | Ga0466701_020347 | Ga0466701_020347_223_654 | 143 |
| 132 | 3300005071 | Ga0068302_10103457 | Ga0068302_101034571 | 144 |
| 133 | 3300005200 | Ga0072940_1230846 | Ga0072940_12308462 | 144 |
| 134 | 3300000062 | IMNBL1DRAFT_c0001726 | IMNBL1DRAFT_00017266 | 145 |
| 135 | 3300002504 | JGI24705J35276_12155705 | JGI24705J35276_121557051 | 148 |
| 136 | 3300042597 | Ga0466699_170876 | Ga0466699_170876_789_1235 | 148 |
| 137 | 3300042614 | Ga0466712_203007 | Ga0466712_203007_534_983 | 149 |
| 138 | 3300002449 | JGI24698J34947_10003846 | JGI24698J34947_100038467 | 150 |
| 139 | iso_pr_bacteria | 2740892545 | 2743908275 | 150 |
| 140 | 3300000089 | AustNasuHG_c1010300 | AustNasuHG_10103001 | 151 |
| 141 | 3300000089 | AustNasuHG_c1030873 | AustNasuHG_10308732 | 151 |
| 142 | 3300005200 | Ga0072940_1023271 | Ga0072940_102327116 | 151 |
| 143 | iso_pr_bacteria | 2778260941 | 2778358408 | 152 |
| 144 | 3300042656 | Ga0466732_024502 | Ga0466732_024502_438_899 | 153 |
| 145 | 3300042614 | Ga0466712_023404 | Ga0466712_023404_226_690 | 154 |
| 146 | 3300042617 | Ga0466718_036071 | Ga0466718_036071_5031_5501 | 156 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13470 | PIN_3 | PIN domain | 2 | 112 | 0.8 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.81 | 0.85 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.