Protein Family IF07881

Metagenome Isolate
203 Members
50 Samples
188 Scaffolds
140.83 Avg Length

🧬 Representative Sequence

ID
3300042617|Ga0466718_023786|Ga0466718_023786_5607_6077
Length
156 aa
Sequence
VKRFRFNLEKVLELRQYREEEAKNELGRAISILTAIENNIKQNALIRTQAVQQRFTGLTDADSGGDITANVIDAGTAAASMLAWDTYILRLEQEAERLMEDAARAEMVVEEKRNQYLEASRELKVMEKXXXXREVEYRKEFFAAETRELDDMWRAK

📊 Sample Types

Isolate 7.4%
Metagenome 92.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 55.3%
Unclassified 31.9%
Rhinotermitidae 6.4%
Kalotermitidae 4.3%
Termopsidae 2.1%

🌳 Taxonomy

Archaea 2
Bacteria 173
Eukaryota 0
Viruses 0
Unclassified 28

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
2 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
3 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
4 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
5 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
6 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
7 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
8 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
9 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
10 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
11 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
12 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
13 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
14 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
15 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
16 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
17 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
18 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
19 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
20 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
21 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
22 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
23 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
24 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
25 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
26 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
27 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
28 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
29 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
30 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
31 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
32 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
33 2228664003 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA Metagenome Termitidae
34 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
35 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
36 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
37 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
38 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
39 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
40 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
41 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
42 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
43 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
44 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
45 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
46 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
47 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
48 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
49 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
50 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123356_10039660 3300010049 Bacteria 4387
2 Ga0123356_10120604 3300010049 Bacteria 2550
3 Ga0466720_034495 3300042607 Bacteria 7422
4 Ga0466720_195652 3300042607 Bacteria 5160
5 Ga0466722_061542 3300042609 Bacteria 32040
6 Ga0466711_113548 3300042615 Bacteria 36298
7 Ga0466718_002717 3300042617 Bacteria 4589
8 Ga0466718_019723 3300042617 Bacteria 1641
9 Ga0466718_023786 3300042617 Bacteria 24556
10 2230954208 2228664003 Bacteria 14647
11 AustNasuHG_c1006332 3300000089 Bacteria 4229
12 AustNasuHG_c1018291 3300000089 Bacteria 2316
13 JGI24698J34947_10042777 3300002449 Bacteria 2325
14 JGI24695J34938_10000389 3300002450 Bacteria 43422
15 JGI24695J34938_10346522 3300002450 Bacteria 652
16 Ga0072941_1008006 3300005201 Bacteria 25853
17 Ga0466694_072434 3300042594 Unclassified 1697
18 Ga0466699_140559 3300042597 Bacteria 3024
19 Ga0466699_162737 3300042597 Bacteria 1477
20 Ga0466699_438442 3300042597 Bacteria 3461
21 Ga0466702_058589 3300042635 Unclassified 1037
22 Ga0123356_10444148 3300010049 Bacteria 1444
23 Ga0123356_11303105 3300010049 Bacteria 890
24 Ga0466712_019495 3300042614 Bacteria 40574
25 Ga0466712_116274 3300042614 Bacteria 1144
26 Ga0466712_157449 3300042614 Bacteria 12179
27 Ga0466712_189528 3300042614 Bacteria 31608
28 Ga0466712_243529 3300042614 Bacteria 40070
29 AustNasuHG_c1000040 3300000089 Bacteria 32335
30 AustNasuHG_c1045223 3300000089 Unclassified 1009
31 JGI24698J34947_10027034 3300002449 Bacteria 3045
32 JGI24698J34947_10053819 3300002449 Bacteria 2012
33 JGI24698J34947_10078172 3300002449 Unclassified 1562
34 JGI24698J34947_10178947 3300002449 Unclassified 850
35 JGI24698J34947_10205597 3300002449 Bacteria 767
36 JGI24698J34947_10251446 3300002449 Bacteria 660
37 JGI24695J34938_10003239 3300002450 Bacteria 11521
38 JGI24702J35022_10166351 3300002462 Bacteria 1245
39 Ga0072941_1001892 3300005201 Bacteria 14106
40 Ga0072941_1009205 3300005201 Bacteria 9109
41 Ga0072941_1074335 3300005201 Archaea 1338
42 Ga0264413_101301 3300024493 Bacteria 53125
43 Ga0466694_031624 3300042594 Unclassified 8049
44 Ga0466694_131062 3300042594 Bacteria 33615
45 Ga0466694_259804 3300042594 Bacteria 8540
46 Ga0466699_101657 3300042597 Bacteria 2448
47 Ga0466699_142185 3300042597 Bacteria 1417
48 Ga0466699_165990 3300042597 Bacteria 1703
49 Ga0466699_188045 3300042597 Bacteria 1363
50 Ga0466699_213566 3300042597 Bacteria 1460
51 Ga0466699_300259 3300042597 Bacteria 2131
52 Ga0466699_310486 3300042597 Bacteria 2026
53 Ga0123356_10099506 3300010049 Bacteria 2787
54 Ga0123356_11394083 3300010049 Unclassified 861
55 Ga0466720_133583 3300042607 Bacteria 12645
56 Ga0466712_018661 3300042614 Bacteria 7702
57 Ga0466712_035383 3300042614 Bacteria 4365
58 Ga0466718_068035 3300042617 Bacteria 3717
59 AustNasuHG_c1025889 3300000089 Unclassified 1837
60 JGI24698J34947_10000683 3300002449 Bacteria 16580
61 JGI24698J34947_10068312 3300002449 Unclassified 1719
62 JGI24698J34947_10132993 3300002449 Bacteria 1060
63 JGI24695J34938_10000129 3300002450 Bacteria 68011
64 JGI24695J34938_10005528 3300002450 Bacteria 7846
65 Ga0072941_1060656 3300005201 Bacteria 6858
66 Ga0072941_1074337 3300005201 Archaea 1296
67 Ga0415639_121199 3300038395 Unclassified 1220
68 Ga0466694_046618 3300042594 Bacteria 2859
69 Ga0466699_157179 3300042597 Bacteria 20450
70 Ga0466699_340953 3300042597 Bacteria 3175
71 Ga0466699_352997 3300042597 Unclassified 1168
72 Ga0123356_10000007 3300010049 Bacteria 240704
73 Ga0123356_10033810 3300010049 Bacteria 4781
74 Ga0466700_012865 3300042600 Bacteria 8049
75 Ga0466712_073636 3300042614 Bacteria 2873
76 Ga0466712_078600 3300042614 Unclassified 1428
77 Ga0466712_148379 3300042614 Bacteria 4482
78 Ga0466712_154562 3300042614 Bacteria 2088
79 Ga0466712_155558 3300042614 Bacteria 36572
80 Ga0466718_021146 3300042617 Bacteria 1404
81 Ga0466718_073471 3300042617 Bacteria 1768
82 FAAS_10320160 3300001880 Bacteria 540
83 JGI24698J34947_10025032 3300002449 Bacteria 3180
84 JGI24698J34947_10066995 3300002449 Bacteria 1744
85 JGI24698J34947_10222825 3300002449 Unclassified 722
86 JGI24695J34938_10000145 3300002450 Bacteria 64417
87 JGI24695J34938_10018976 3300002450 Unclassified 3420
88 JGI24695J34938_10019183 3300002450 Bacteria 3397
89 JGI24695J34938_10106250 3300002450 Unclassified 1145
90 Ga0072941_1112546 3300005201 Unclassified 673
91 Ga0264413_108946 3300024493 Bacteria 7109
92 Ga0466692_070854 3300042591 Bacteria 20045
93 Ga0466694_055965 3300042594 Bacteria 1199
94 Ga0466696_420222 3300042596 Bacteria 1296
95 Ga0466699_226132 3300042597 Bacteria 1858
96 Ga0466727_194406 3300042655 Bacteria 1908
97 Ga0466727_288852 3300042655 Bacteria 3064
98 Ga0123355_12072023 3300009826 Unclassified 525
99 Ga0123356_10002504 3300010049 Bacteria 19617
100 Ga0123356_10104204 3300010049 Bacteria 2726
101 Ga0123356_10346754 3300010049 Bacteria 1607
102 Ga0123353_10029314 3300010167 Bacteria 8479
103 Ga0466714_081418 3300042603 Bacteria 1244
104 Ga0466720_127104 3300042607 Bacteria 5141
105 Ga0466720_146301 3300042607 Bacteria 5759
106 Ga0466721_186075 3300042608 Bacteria 7091
107 Ga0466712_021559 3300042614 Bacteria 1890
108 Ga0466712_276017 3300042614 Bacteria 3522
109 Ga0466712_317019 3300042614 Bacteria 19678
110 FAAS_10005014 3300001880 Bacteria 1860
111 JGI24698J34947_10079980 3300002449 Bacteria 1537
112 JGI24695J34938_10000049 3300002450 Bacteria 91446
113 JGI24697J35500_11271684 3300002507 Bacteria 4627
114 JGI24699J35502_11131587 3300002509 Bacteria 5835
115 Ga0072941_1044784 3300005201 Unclassified 8155
116 Ga0415639_020314 3300038395 Bacteria 9683
117 Ga0466695_094031 3300042595 Bacteria 1148
118 Ga0466699_013161 3300042597 Bacteria 2163
119 Ga0466699_086658 3300042597 Bacteria 6937
120 Ga0466699_087230 3300042597 Bacteria 1338
121 Ga0466699_232564 3300042597 Bacteria 10200
122 Ga0466699_368546 3300042597 Bacteria 23219
123 Ga0466731_204522 3300042622 Bacteria 5174
124 Ga0123356_10035604 3300010049 Bacteria 4650
125 Ga0123356_10043162 3300010049 Bacteria 4198
126 Ga0123356_10611182 3300010049 Bacteria 1255
127 Ga0123356_10892885 3300010049 Unclassified 1060
128 Ga0123353_11858066 3300010167 Unclassified 745
129 Ga0466700_170024 3300042600 Unclassified 1803
130 Ga0466712_230650 3300042614 Bacteria 3853
131 Ga0466712_244485 3300042614 Bacteria 43012
132 Ga0466718_037064 3300042617 Bacteria 21925
133 Ga0466718_130846 3300042617 Bacteria 1678
134 JGI24698J34947_10008240 3300002449 Bacteria 5717
135 JGI24698J34947_10079953 3300002449 Unclassified 1537
136 JGI24698J34947_10109578 3300002449 Unclassified 1222
137 JGI24695J34938_10000452 3300002450 Bacteria 39831
138 JGI24702J35022_10000469 3300002462 Bacteria 24350
139 Ga0072940_1116421 3300005200 Bacteria 11619
140 Ga0072941_1091037 3300005201 Bacteria 4471
141 Ga0415639_109310 3300038395 Bacteria 4371
142 Ga0466699_041998 3300042597 Bacteria 4711
143 Ga0466699_042125 3300042597 Bacteria 1738
144 Ga0466699_268259 3300042597 Bacteria 1543
145 Ga0466699_442338 3300042597 Bacteria 24832
146 Ga0466731_291634 3300042622 Bacteria 2388
147 Ga0466702_035489 3300042635 Bacteria 5745
148 Ga0466702_324184 3300042635 Bacteria 2147
149 Ga0123356_10037737 3300010049 Unclassified 4505
150 Ga0123356_10458838 3300010049 Bacteria 1424
151 Ga0123353_11621034 3300010167 Unclassified 816
152 Ga0123354_10365073 3300010882 Bacteria 1267
153 Ga0466712_146866 3300042614 Bacteria 2095
154 Ga0466718_122630 3300042617 Bacteria 1900
155 Ga0466718_155504 3300042617 Bacteria 21802
156 JGI24698J34947_10000082 3300002449 Bacteria 31148
157 JGI24698J34947_10034088 3300002449 Bacteria 2667
158 JGI24698J34947_10053746 3300002449 Bacteria 2014
159 JGI24698J34947_10159908 3300002449 Bacteria 924
160 Ga0072941_1082966 3300005201 Bacteria 1243
161 Ga0072941_1412128 3300005201 Bacteria 771
162 Ga0415639_029747 3300038395 Bacteria 6296
163 Ga0466692_032549 3300042591 Unclassified 1510
164 Ga0466694_058636 3300042594 Bacteria 21238
165 Ga0466699_035638 3300042597 Bacteria 6154
166 Ga0466699_262288 3300042597 Unclassified 1640
167 Ga0466732_346610 3300042656 Bacteria 10879
168 Ga0123356_10000212 3300010049 Bacteria 67664
169 Ga0123356_10017438 3300010049 Bacteria 6831
170 Ga0123353_10345078 3300010167 Bacteria 2247
171 Ga0123353_10566758 3300010167 Unclassified 1633
172 Ga0466718_011731 3300042617 Bacteria 12742
173 Ga0466718_100000 3300042617 Bacteria 14213
174 JGI24698J34947_10004355 3300002449 Bacteria 7701
175 JGI24698J34947_10059346 3300002449 Bacteria 1891
176 JGI24695J34938_10001693 3300002450 Bacteria 18256
177 Ga0072941_1045865 3300005201 Bacteria 3692
178 Ga0456237_0011462 3300041968 Bacteria 1294
179 Ga0466693_419846 3300042592 Bacteria 23203
180 Ga0466694_095227 3300042594 Bacteria 2292
181 Ga0466694_238242 3300042594 Bacteria 12526
182 Ga0466699_000324 3300042597 Bacteria 6118
183 Ga0466699_151168 3300042597 Bacteria 1697
184 Ga0466699_213252 3300042597 Bacteria 1978
185 Ga0466699_322674 3300042597 Bacteria 75586
186 Ga0466731_053736 3300042622 Bacteria 1182
187 Ga0466702_253289 3300042635 Bacteria 4519
188 Ga0466702_360661 3300042635 Bacteria 2966

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02050 FliJ Flagellar FliJ protein 70 152 0.9

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.