Protein Family IF07868
Metagenome
Metatranscriptome
Isolate
133
Members
33
Samples
131
Scaffolds
122.14
Avg Length
Representative Sequence
- ID
- 3300042617|Ga0466718_012171|Ga0466718_012171_191_628
- Length
- 145 aa
- Sequence
- MRIKMLLWGIFYGILIKMGKMAVSINVRIKAVRKALGLSQRAFCRGIYLSQGFYAQIESGGKKANERIYELIATKYNVNKDWLLTGKGEMFCGPAPDLELEQLIEIYKELDPLFKEYVMLQIKQLLNVQKQSRGEKKTHSKDVDK
Sample Types
Isolate
1.5%
Metagenome
97.7%
MAG
0.0%
Metatranscriptome
0.8%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
53.3%
Kalotermitidae
20.0%
Rhinotermitidae
10.0%
Unclassified
10.0%
Termopsidae
6.7%
Taxonomy
Archaea
0
Bacteria
114
Eukaryota
0
Viruses
0
Unclassified
19
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 3 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 4 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 5 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 6 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 7 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 8 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 9 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 10 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 11 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 12 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 13 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 14 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 15 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 16 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 17 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 18 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 19 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 20 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 21 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 22 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 23 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 24 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 25 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 26 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 27 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 28 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 29 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 30 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 31 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 32 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 33 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_318791 | 3300042612 | Bacteria | 2028 |
| 2 | Ga0466732_126609 | 3300042656 | Bacteria | 1163 |
| 3 | Ga0466732_163306 | 3300042656 | Unclassified | 1291 |
| 4 | Ga0466732_199807 | 3300042656 | Bacteria | 1564 |
| 5 | AustNasuHG_c1015604 | 3300000089 | Bacteria | 2560 |
| 6 | AustNasuHG_c1028390 | 3300000089 | Bacteria | 1673 |
| 7 | Ga0072941_1023700 | 3300005201 | Unclassified | 3347 |
| 8 | Ga0466718_016768 | 3300042617 | Bacteria | 1189 |
| 9 | Ga0466718_090667 | 3300042617 | Bacteria | 2936 |
| 10 | Ga0466718_128870 | 3300042617 | Bacteria | 11587 |
| 11 | Ga0466707_186759 | 3300042601 | Bacteria | 3242 |
| 12 | Ga0466720_117556 | 3300042607 | Bacteria | 1746 |
| 13 | Ga0466720_216720 | 3300042607 | Bacteria | 1501 |
| 14 | Ga0466722_026493 | 3300042609 | Bacteria | 1611 |
| 15 | Ga0466698_264343 | 3300042610 | Bacteria | 1113 |
| 16 | AustNasuHG_c1012403 | 3300000089 | Bacteria | 2943 |
| 17 | JGI24695J34938_10093628 | 3300002450 | Bacteria | 1231 |
| 18 | Ga0466712_126574 | 3300042614 | Bacteria | 9634 |
| 19 | Ga0466715_359386 | 3300042616 | Bacteria | 1366 |
| 20 | Ga0466718_030231 | 3300042617 | Bacteria | 8969 |
| 21 | Ga0255786_1033715 | 3300022815 | Bacteria | 824 |
| 22 | Ga0264413_110240 | 3300024493 | Unclassified | 5231 |
| 23 | Ga0466694_289647 | 3300042594 | Bacteria | 2625 |
| 24 | Ga0466720_233867 | 3300042607 | Bacteria | 5712 |
| 25 | Ga0466698_317291 | 3300042610 | Bacteria | 1398 |
| 26 | Ga0466729_259208 | 3300042621 | Bacteria | 2458 |
| 27 | Ga0466703_029820 | 3300042636 | Bacteria | 18253 |
| 28 | Ga0466704_208883 | 3300042643 | Bacteria | 6551 |
| 29 | Ga0466708_236520 | 3300042652 | Unclassified | 5806 |
| 30 | Ga0466708_247037 | 3300042652 | Bacteria | 2213 |
| 31 | Ga0466732_243348 | 3300042656 | Bacteria | 1030 |
| 32 | AustNasuHG_c1066090 | 3300000089 | Bacteria | 673 |
| 33 | JGI24698J34947_10070005 | 3300002449 | Unclassified | 1691 |
| 34 | JGI24697J35500_10589426 | 3300002507 | Bacteria | 577 |
| 35 | JGI24699J35502_10706251 | 3300002509 | Bacteria | 772 |
| 36 | Ga0072940_1003379 | 3300005200 | Bacteria | 4613 |
| 37 | Ga0123356_10000596 | 3300010049 | Bacteria | 40097 |
| 38 | Ga0466694_026238 | 3300042594 | Bacteria | 1460 |
| 39 | Ga0466707_216797 | 3300042601 | Bacteria | 1135 |
| 40 | Ga0466720_143130 | 3300042607 | Bacteria | 2979 |
| 41 | Ga0466732_076071 | 3300042656 | Bacteria | 12233 |
| 42 | Ga0466732_447500 | 3300042656 | Unclassified | 1744 |
| 43 | AustNasuHG_c1004456 | 3300000089 | Bacteria | 5020 |
| 44 | JGI24698J34947_10005950 | 3300002449 | Bacteria | 6694 |
| 45 | JGI24698J34947_10008455 | 3300002449 | Unclassified | 5653 |
| 46 | JGI24698J34947_10010778 | 3300002449 | Bacteria | 5017 |
| 47 | JGI24698J34947_10011086 | 3300002449 | Bacteria | 4946 |
| 48 | JGI24698J34947_10024717 | 3300002449 | Unclassified | 3205 |
| 49 | JGI24698J34947_10314644 | 3300002449 | Unclassified | 559 |
| 50 | JGI24695J34938_10101839 | 3300002450 | Bacteria | 1173 |
| 51 | JGI24695J34938_10295572 | 3300002450 | Bacteria | 699 |
| 52 | Ga0466712_021224 | 3300042614 | Bacteria | 6299 |
| 53 | Ga0466712_246177 | 3300042614 | Bacteria | 1851 |
| 54 | Ga0466712_323046 | 3300042614 | Unclassified | 4079 |
| 55 | Ga0466718_062382 | 3300042617 | Bacteria | 1471 |
| 56 | Ga0466718_139900 | 3300042617 | Bacteria | 2200 |
| 57 | Ga0466699_014028 | 3300042597 | Bacteria | 7432 |
| 58 | Ga0466707_213907 | 3300042601 | Bacteria | 1986 |
| 59 | Ga0466720_046083 | 3300042607 | Bacteria | 1181 |
| 60 | Ga0466698_236714 | 3300042610 | Bacteria | 1462 |
| 61 | Ga0466729_243345 | 3300042621 | Bacteria | 1228 |
| 62 | Ga0466709_378541 | 3300042648 | Bacteria | 1314 |
| 63 | Ga0466732_131720 | 3300042656 | Bacteria | 3713 |
| 64 | AustNasuHG_c1000472 | 3300000089 | Bacteria | 14118 |
| 65 | JGI24698J34947_10012668 | 3300002449 | Bacteria | 4618 |
| 66 | JGI24695J34938_10106721 | 3300002450 | Bacteria | 1142 |
| 67 | JGI24695J34938_10120078 | 3300002450 | Unclassified | 1070 |
| 68 | JGI24699J35502_10893802 | 3300002509 | Unclassified | 1033 |
| 69 | JGI24699J35502_11132193 | 3300002509 | Unclassified | 6512 |
| 70 | Ga0072940_1001291 | 3300005200 | Bacteria | 17521 |
| 71 | Ga0072941_1027012 | 3300005201 | Bacteria | 3918 |
| 72 | Ga0072941_1116207 | 3300005201 | Bacteria | 1042 |
| 73 | Ga0466712_064105 | 3300042614 | Bacteria | 16193 |
| 74 | Ga0466712_178526 | 3300042614 | Bacteria | 1186 |
| 75 | Ga0466712_245311 | 3300042614 | Bacteria | 1590 |
| 76 | Ga0466712_286989 | 3300042614 | Bacteria | 1464 |
| 77 | Ga0466715_544498 | 3300042616 | Bacteria | 2179 |
| 78 | Ga0466718_008615 | 3300042617 | Bacteria | 7721 |
| 79 | Ga0466720_037603 | 3300042607 | Bacteria | 5628 |
| 80 | Ga0466732_061575 | 3300042656 | Bacteria | 1108 |
| 81 | Ga0466732_196621 | 3300042656 | Bacteria | 1011 |
| 82 | Ga0466732_232528 | 3300042656 | Bacteria | 2149 |
| 83 | Ga0466732_303156 | 3300042656 | Bacteria | 1022 |
| 84 | AustNasuHG_c1020082 | 3300000089 | Unclassified | 2181 |
| 85 | JGI24698J34947_10068449 | 3300002449 | Bacteria | 1717 |
| 86 | JGI24698J34947_10185400 | 3300002449 | Unclassified | 828 |
| 87 | JGI24698J34947_10201872 | 3300002449 | Bacteria | 778 |
| 88 | Ga0072941_1068231 | 3300005201 | Bacteria | 4374 |
| 89 | Ga0466712_050158 | 3300042614 | Bacteria | 7415 |
| 90 | Ga0466712_264599 | 3300042614 | Bacteria | 2275 |
| 91 | Ga0466712_268980 | 3300042614 | Bacteria | 1210 |
| 92 | Ga0466718_078038 | 3300042617 | Bacteria | 7799 |
| 93 | Ga0466726_290368 | 3300042619 | Bacteria | 1293 |
| 94 | Ga0264413_110250 | 3300024493 | Bacteria | 7849 |
| 95 | Ga0466694_134186 | 3300042594 | Bacteria | 3427 |
| 96 | Ga0466699_388514 | 3300042597 | Bacteria | 6516 |
| 97 | Ga0466698_223572 | 3300042610 | Bacteria | 1415 |
| 98 | Ga0466709_050464 | 3300042648 | Bacteria | 5918 |
| 99 | AustNasuHG_c1001436 | 3300000089 | Bacteria | 8531 |
| 100 | FAAS_10333613 | 3300001880 | Bacteria | 518 |
| 101 | JGI24698J34947_10000241 | 3300002449 | Bacteria | 22787 |
| 102 | JGI24698J34947_10069897 | 3300002449 | Unclassified | 1692 |
| 103 | JGI24698J34947_10281728 | 3300002449 | Bacteria | 607 |
| 104 | Ga0466712_036358 | 3300042614 | Bacteria | 13684 |
| 105 | Ga0466712_092683 | 3300042614 | Bacteria | 8365 |
| 106 | Ga0466712_113831 | 3300042614 | Bacteria | 4775 |
| 107 | Ga0466712_256319 | 3300042614 | Bacteria | 12079 |
| 108 | Ga0466718_014897 | 3300042617 | Bacteria | 4004 |
| 109 | Ga0466718_057718 | 3300042617 | Bacteria | 3807 |
| 110 | Ga0456237_0001473 | 3300041968 | Bacteria | 3747 |
| 111 | Ga0466694_387484 | 3300042594 | Bacteria | 1547 |
| 112 | Ga0466707_037706 | 3300042601 | Unclassified | 1471 |
| 113 | Ga0466707_353901 | 3300042601 | Bacteria | 2800 |
| 114 | Ga0466735_019643 | 3300042624 | Bacteria | 7920 |
| 115 | Ga0466730_073323 | 3300042625 | Bacteria | 1556 |
| 116 | Ga0466705_239313 | 3300042612 | Bacteria | 3063 |
| 117 | AustNasuHG_c1001086 | 3300000089 | Bacteria | 9762 |
| 118 | AustNasuHG_c1004104 | 3300000089 | Unclassified | 5233 |
| 119 | AustNasuHG_c1014664 | 3300000089 | Bacteria | 2657 |
| 120 | JGI24698J34947_10001374 | 3300002449 | Bacteria | 12792 |
| 121 | JGI24698J34947_10015731 | 3300002449 | Bacteria | 4114 |
| 122 | JGI24698J34947_10065933 | 3300002449 | Unclassified | 1763 |
| 123 | JGI24698J34947_10298301 | 3300002449 | Bacteria | 582 |
| 124 | Ga0466712_289414 | 3300042614 | Bacteria | 1667 |
| 125 | Ga0466718_012171 | 3300042617 | Bacteria | 1189 |
| 126 | Ga0466718_067721 | 3300042617 | Bacteria | 37185 |
| 127 | Ga0466718_134187 | 3300042617 | Bacteria | 2384 |
| 128 | Ga0264413_117449 | 3300024493 | Bacteria | 1166 |
| 129 | Ga0466699_133211 | 3300042597 | Bacteria | 6318 |
| 130 | Ga0466720_060547 | 3300042607 | Bacteria | 16968 |
| 131 | Ga0466720_093070 | 3300042607 | Bacteria | 7339 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.