Protein Family IF07864
Metagenome
Isolate
157
Members
54
Samples
144
Scaffolds
313.55
Avg Length
Representative Sequence
- ID
- 3300042617|Ga0466718_007950|Ga0466718_007950_2715_3785
- Length
- 356 aa
- Sequence
- MTVPQYTFPFKHLLGIEPLSPLDVTSILDQAKAFEEVCENPEIKVVPALRKKLVVNLFFENSTRTRNSFEIAEKRLSAEIVNFDAGSSSLSKGETLIDTATNLQAMRPDIIVMRHSAPGAHTLLARHIDASIVNAGDGAHEHPTQALLDAYTMREHFGKLNGLSVAIVGDIRNSRVVRSNLWLLTKMGAKVTLVGPPTLLPAEIKETWPDVELSYDFDEVIPSMDVIMMLRCQFERGTGMYIPSQGEYAKYYQLNAARMKRAGNEAVVLHPGPLNRGVEITSEVADGPNSLILKQVTNGVPVRMSVLHLLIPSRVQLTLNAKTPKFLKNRGNLIFQKLAGGDCSPPYQPAIKRNAV
Sample Types
Isolate
8.3%
Metagenome
91.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
28.8%
Unclassified
26.9%
Kalotermitidae
25.0%
Termopsidae
7.7%
Rhinotermitidae
5.8%
Ixodidae
3.8%
Hodotermitidae
1.9%
Taxonomy
Archaea
0
Bacteria
143
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820316744 | Unclassified Firmicutes Nt197P3bin99 | Isolate | Unclassified |
| 2 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 10 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 11 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 12 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 13 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 14 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 15 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 16 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 17 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 18 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 19 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 20 | 2772190893 | Unclassified Elusimicrobia Nt197P4_bin29 | Isolate | Unclassified |
| 21 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 22 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 23 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 24 | 2820946191 | Unclassified Acidobacteria Nt197P3bin31 | Isolate | Unclassified |
| 25 | 2772190894 | Unclassified Elusimicrobia Th196P4_bin33 | Isolate | Unclassified |
| 26 | 3002773460 | Coxiella endosymbiont of Amblyomma nuttalli Craf2019 | Isolate | Ixodidae |
| 27 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 28 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 29 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 30 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 31 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 32 | 2718217749 | Coxiella mudrowiae CRt | Isolate | Ixodidae |
| 33 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 34 | 642555172 | Endomicrobium trichonymphae Rs-D17 | Isolate | Unclassified |
| 35 | 2754412482 | Unclassified Elusimicrobia Emb289P3bin85 | Isolate | Unclassified |
| 36 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 37 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 38 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 39 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 40 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 41 | 2820947865 | Unclassified Acidobacteria Nt197P3bin133 | Isolate | Unclassified |
| 42 | 2772190891 | Unclassified Elusimicrobia Emb289P1_bin41 | Isolate | Unclassified |
| 43 | 2772190895 | Unclassified Elusimicrobia Emb289P1_bin39 | Isolate | Unclassified |
| 44 | 2775506951 | Candidatus Coxiella mudrowiae CRS-CAT | Isolate | Unclassified |
| 45 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 46 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 47 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 48 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 49 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 50 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 51 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 52 | 2772190892 | Unclassified Elusimicrobia Lab288P3_bin37 | Isolate | Unclassified |
| 53 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 54 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466711_117944 | 3300042615 | Bacteria | 215972 |
| 2 | Ga0466711_157498 | 3300042615 | Bacteria | 313285 |
| 3 | Ga0466711_265258 | 3300042615 | Bacteria | 7246 |
| 4 | Ga0466715_103053 | 3300042616 | Unclassified | 5180 |
| 5 | Ga0466715_127873 | 3300042616 | Bacteria | 35795 |
| 6 | Ga0466715_333597 | 3300042616 | Bacteria | 13294 |
| 7 | Ga0466718_059104 | 3300042617 | Bacteria | 1549 |
| 8 | Ga0466723_001713 | 3300042618 | Bacteria | 31744 |
| 9 | Ga0466726_123966 | 3300042619 | Bacteria | 58399 |
| 10 | Ga0466726_456122 | 3300042619 | Bacteria | 5072 |
| 11 | Ga0466706_019380 | 3300042599 | Bacteria | 325727 |
| 12 | Ga0466707_057336 | 3300042601 | Bacteria | 145123 |
| 13 | Ga0466720_156955 | 3300042607 | Bacteria | 19095 |
| 14 | Ga0466722_024763 | 3300042609 | Bacteria | 8366 |
| 15 | Ga0466735_132141 | 3300042624 | Bacteria | 3038 |
| 16 | Ga0466702_171435 | 3300042635 | Bacteria | 1973 |
| 17 | Ga0466703_395188 | 3300042636 | Bacteria | 299836 |
| 18 | Ga0466708_109042 | 3300042652 | Bacteria | 18567 |
| 19 | Ga0466690_132207 | 3300042590 | Bacteria | 6870 |
| 20 | Ga0466690_176555 | 3300042590 | Unclassified | 2140 |
| 21 | Ga0466690_198783 | 3300042590 | Bacteria | 25547 |
| 22 | Ga0466691_166853 | 3300042593 | Bacteria | 43003 |
| 23 | Ga0466691_228168 | 3300042593 | Bacteria | 2953 |
| 24 | Ga0466695_093981 | 3300042595 | Bacteria | 10205 |
| 25 | Ga0466699_031483 | 3300042597 | Bacteria | 3513 |
| 26 | Ga0123357_10002492 | 3300009784 | Bacteria | 20574 |
| 27 | Ga0466705_143986 | 3300042612 | Bacteria | 113378 |
| 28 | Ga0466705_320552 | 3300042612 | Unclassified | 5260 |
| 29 | Ga0466715_310943 | 3300042616 | Bacteria | 2736 |
| 30 | Ga0466726_471691 | 3300042619 | Bacteria | 4899 |
| 31 | Ga0466728_017755 | 3300042620 | Bacteria | 55878 |
| 32 | Ga0466706_133635 | 3300042599 | Bacteria | 49917 |
| 33 | Ga0466722_111965 | 3300042609 | Bacteria | 6515 |
| 34 | Ga0466729_253898 | 3300042621 | Bacteria | 37673 |
| 35 | Ga0466735_015327 | 3300042624 | Bacteria | 6303 |
| 36 | Ga0466727_164812 | 3300042655 | Bacteria | 1866 |
| 37 | Ga0466691_028492 | 3300042593 | Unclassified | 12293 |
| 38 | Ga0466696_221627 | 3300042596 | Bacteria | 39465 |
| 39 | JGI24702J35022_10000598 | 3300002462 | Bacteria | 21862 |
| 40 | Ga0068305_10000168 | 3300005083 | Bacteria | 304006 |
| 41 | Ga0068305_10000397 | 3300005083 | Bacteria | 13921 |
| 42 | Ga0068305_10000968 | 3300005083 | Bacteria | 34979 |
| 43 | Ga0072940_1045887 | 3300005200 | Bacteria | 6956 |
| 44 | Ga0466712_040064 | 3300042614 | Unclassified | 6189 |
| 45 | Ga0466711_287570 | 3300042615 | Bacteria | 16520 |
| 46 | Ga0466726_215331 | 3300042619 | Bacteria | 15976 |
| 47 | Ga0466706_010205 | 3300042599 | Bacteria | 97987 |
| 48 | Ga0466707_154688 | 3300042601 | Bacteria | 30924 |
| 49 | Ga0466707_249394 | 3300042601 | Unclassified | 2295 |
| 50 | Ga0466713_110936 | 3300042602 | Bacteria | 53952 |
| 51 | Ga0466714_135782 | 3300042603 | Bacteria | 52371 |
| 52 | Ga0466716_064536 | 3300042605 | Bacteria | 4897 |
| 53 | Ga0466720_168619 | 3300042607 | Bacteria | 2482 |
| 54 | Ga0466735_090745 | 3300042624 | Bacteria | 20038 |
| 55 | Ga0466703_053256 | 3300042636 | Bacteria | 45065 |
| 56 | Ga0466703_250320 | 3300042636 | Bacteria | 592480 |
| 57 | Ga0264413_138776 | 3300024493 | Bacteria | 4106 |
| 58 | Ga0466711_224592 | 3300042615 | Bacteria | 117488 |
| 59 | Ga0466715_169080 | 3300042616 | Bacteria | 66239 |
| 60 | Ga0466728_138454 | 3300042620 | Bacteria | 82446 |
| 61 | Ga0466729_129365 | 3300042621 | Bacteria | 10639 |
| 62 | Ga0123356_10000011 | 3300010049 | Bacteria | 212061 |
| 63 | Ga0466706_147376 | 3300042599 | Bacteria | 7549 |
| 64 | Ga0466707_212280 | 3300042601 | Bacteria | 15661 |
| 65 | Ga0466704_063191 | 3300042643 | Bacteria | 120263 |
| 66 | Ga0466727_094531 | 3300042655 | Bacteria | 13359 |
| 67 | Ga0264413_146117 | 3300024493 | Bacteria | 3378 |
| 68 | Ga0466690_174513 | 3300042590 | Unclassified | 4119 |
| 69 | Ga0466699_188878 | 3300042597 | Bacteria | 1031 |
| 70 | JGI24698J34947_10008966 | 3300002449 | Bacteria | 5485 |
| 71 | Ga0068305_10000200 | 3300005083 | Bacteria | 53590 |
| 72 | Ga0466705_171019 | 3300042612 | Bacteria | 78873 |
| 73 | Ga0466711_189352 | 3300042615 | Bacteria | 31754 |
| 74 | Ga0466715_098538 | 3300042616 | Bacteria | 131452 |
| 75 | Ga0466715_529631 | 3300042616 | Bacteria | 1540 |
| 76 | Ga0466723_086442 | 3300042618 | Unclassified | 40541 |
| 77 | Ga0466723_132897 | 3300042618 | Unclassified | 4435 |
| 78 | Ga0466723_185602 | 3300042618 | Bacteria | 3488 |
| 79 | Ga0466726_487692 | 3300042619 | Unclassified | 4305 |
| 80 | Ga0466728_000888 | 3300042620 | Bacteria | 24408 |
| 81 | Ga0466728_011302 | 3300042620 | Bacteria | 42378 |
| 82 | Ga0466728_361688 | 3300042620 | Bacteria | 4277 |
| 83 | Ga0123357_10026111 | 3300009784 | Bacteria | 7887 |
| 84 | Ga0466706_085003 | 3300042599 | Bacteria | 195523 |
| 85 | Ga0466719_524336 | 3300042606 | Bacteria | 382683 |
| 86 | Ga0466729_260206 | 3300042621 | Bacteria | 8363 |
| 87 | Ga0466704_044414 | 3300042643 | Bacteria | 14909 |
| 88 | Ga0466704_484548 | 3300042643 | Bacteria | 86716 |
| 89 | Ga0466727_277996 | 3300042655 | Bacteria | 60667 |
| 90 | Ga0466690_090696 | 3300042590 | Bacteria | 21927 |
| 91 | Ga0466690_197002 | 3300042590 | Bacteria | 40399 |
| 92 | Ga0466692_018864 | 3300042591 | Bacteria | 7086 |
| 93 | JGI24698J34947_10051858 | 3300002449 | Bacteria | 2061 |
| 94 | Ga0466726_099748 | 3300042619 | Bacteria | 172717 |
| 95 | Ga0466726_115500 | 3300042619 | Bacteria | 71251 |
| 96 | Ga0466726_346353 | 3300042619 | Bacteria | 1903 |
| 97 | Ga0466729_103413 | 3300042621 | Bacteria | 5763 |
| 98 | Ga0466707_002099 | 3300042601 | Bacteria | 35814 |
| 99 | Ga0466719_027300 | 3300042606 | Bacteria | 27916 |
| 100 | Ga0466719_102704 | 3300042606 | Bacteria | 110867 |
| 101 | Ga0466735_015735 | 3300042624 | Bacteria | 7934 |
| 102 | Ga0466735_072457 | 3300042624 | Bacteria | 18161 |
| 103 | Ga0466735_214536 | 3300042624 | Bacteria | 2333 |
| 104 | Ga0466727_067113 | 3300042655 | Bacteria | 13193 |
| 105 | Ga0466727_303062 | 3300042655 | Bacteria | 13613 |
| 106 | Ga0466690_105966 | 3300042590 | Bacteria | 18205 |
| 107 | Ga0466696_471219 | 3300042596 | Bacteria | 2248 |
| 108 | Ga0466699_010048 | 3300042597 | Bacteria | 2892 |
| 109 | Ga0068305_10000090 | 3300005083 | Bacteria | 152414 |
| 110 | Ga0466711_517825 | 3300042615 | Bacteria | 192770 |
| 111 | Ga0466718_150770 | 3300042617 | Bacteria | 4470 |
| 112 | Ga0466726_035445 | 3300042619 | Bacteria | 5871 |
| 113 | Ga0123353_10000154 | 3300010167 | Bacteria | 86725 |
| 114 | Ga0466706_280858 | 3300042599 | Bacteria | 94293 |
| 115 | Ga0466713_079335 | 3300042602 | Bacteria | 100418 |
| 116 | Ga0466713_119990 | 3300042602 | Bacteria | 15178 |
| 117 | Ga0466716_081391 | 3300042605 | Unclassified | 5978 |
| 118 | Ga0466719_127211 | 3300042606 | Bacteria | 279481 |
| 119 | Ga0466719_437136 | 3300042606 | Bacteria | 13158 |
| 120 | Ga0466735_050684 | 3300042624 | Bacteria | 14189 |
| 121 | Ga0466735_073637 | 3300042624 | Bacteria | 10214 |
| 122 | Ga0466735_091610 | 3300042624 | Bacteria | 19048 |
| 123 | Ga0466735_107649 | 3300042624 | Bacteria | 13474 |
| 124 | Ga0466702_373688 | 3300042635 | Bacteria | 1147 |
| 125 | Ga0466704_062276 | 3300042643 | Bacteria | 9935 |
| 126 | Ga0466704_170675 | 3300042643 | Bacteria | 15928 |
| 127 | Ga0466704_296765 | 3300042643 | Unclassified | 6379 |
| 128 | Ga0466704_363778 | 3300042643 | Bacteria | 101687 |
| 129 | Ga0466690_125068 | 3300042590 | Unclassified | 2036 |
| 130 | Ga0466699_039932 | 3300042597 | Bacteria | 4966 |
| 131 | Ga0466699_335083 | 3300042597 | Bacteria | 2336 |
| 132 | JGI24705J35276_12238796 | 3300002504 | Bacteria | 82170 |
| 133 | Ga0072941_1237558 | 3300005201 | Bacteria | 8808 |
| 134 | Ga0466715_301796 | 3300042616 | Bacteria | 20559 |
| 135 | Ga0466715_356596 | 3300042616 | Bacteria | 9997 |
| 136 | Ga0466718_007950 | 3300042617 | Bacteria | 5494 |
| 137 | Ga0466723_119125 | 3300042618 | Bacteria | 64079 |
| 138 | Ga0466726_076182 | 3300042619 | Bacteria | 5253 |
| 139 | Ga0123355_10044422 | 3300009826 | Bacteria | 7233 |
| 140 | Ga0466706_093054 | 3300042599 | Bacteria | 81311 |
| 141 | Ga0466720_220277 | 3300042607 | Bacteria | 45060 |
| 142 | Ga0466704_131411 | 3300042643 | Unclassified | 3187 |
| 143 | Ga0068302_10023139 | 3300005071 | Bacteria | 5498 |
| 144 | Ga0072941_1345693 | 3300005201 | Bacteria | 1373 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.