Protein Family IF07846

Metagenome Metatranscriptome Isolate
207 Members
132 Samples
137 Scaffolds
242.67 Avg Length

🧬 Representative Sequence

ID
3300042616|Ga0466715_603110|Ga0466715_603110_976_1827
Length
283 aa
Sequence
MSYFLKKRGKNPKDLKRKLYLREVCNSTMRSIETRKFKFEGRTTMNLEGKTAVISGGARGLGEAMAKLFAEKGARVIACDMGDPQQSYANVEFYKLNVTDVEACGKFFSYAVEKYKKIDILVNNAGITRDGMTRKMTDEMWNLVIDVNLKGVFNLTRLIGPHMEDTGGGSIVNISSIVGEYGNIGQINYAASKAGVIGMSKTWAKEFARKGVPVRCNAIAPGYIMTDILKTVPQELLDKFAASTMLGRLGQPEEIAKVALFLASDDASYVTGTVISANGGMRL

📊 Sample Types

Isolate 33.8%
Metagenome 61.4%
MAG 0.0%
Metatranscriptome 4.8%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 26.2%
Termitidae 18.3%
Apidae 13.5%
Kalotermitidae 9.5%
Tenebrionidae 7.9%
Ixodidae 4.8%
Blattidae 4.0%
Formicidae 2.4%
Chrysomelidae 2.4%
Armadillidiidae 2.4%
Termopsidae 2.4%
Rhinotermitidae 1.6%
Hodotermitidae 0.8%
Scarabaeidae 0.8%
Drosophilidae 0.8%
Culicidae 0.8%
Elmidae 0.8%
Curculionidae 0.8%

🌳 Taxonomy

Archaea 0
Bacteria 194
Eukaryota 0
Viruses 0
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2821316722 Unclassified Actinobacteria Lab288P1bin78 Isolate Unclassified
2 2940400224 Paenibacillus sp. PastM-2 Isolate Blattidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
6 8073544309 Actinomadura sp. RB99 Isolate Termitidae
7 8073617375 Bartonella apis W8098 Isolate Apidae
8 8082291289 Bartonella apihabitans K-FP28 Isolate Apidae
9 644736402 Rickettsia africae ESF-5 Isolate Ixodidae
10 2515154100 Streptomyces sp. MspMP-M5 Isolate Unclassified
11 2751185856 Bartonella apis BBC0244 Isolate Apidae
12 2820481688 Unclassified Firmicutes Lab288P1bin76 Isolate Unclassified
13 2820537337 Unclassified Firmicutes Lab288P1bin137 Isolate Unclassified
14 2820623020 Unclassified Firmicutes Emb289P1bin126 Isolate Unclassified
15 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
16 2582581025 Rickettsia tamurae buchneri ISO7 Isolate Ixodidae
17 2828301124 Sphingomonas leidyi DSM 4733 Isolate Unclassified
18 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
19 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
20 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
21 3300060704 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_PP_oats_c (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
22 8046957834 Streptomyces coacervatus JCM 17138 Isolate Unclassified
23 8068946563 Bartonella apihabitans M0187 Isolate Apidae
24 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
25 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
26 2820602899 Unclassified Firmicutes Emb289P1bin51 Isolate Unclassified
27 2820709481 Unclassified Firmicutes Co191P1bin30 Isolate Unclassified
28 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
29 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
30 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
31 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
32 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
33 2548876780 Rickettsia sibirica BJ-90 Isolate Ixodidae
34 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
35 3300002732 Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs Metagenome
36 3300009453 Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov Metagenome
37 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
38 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
39 2940406939 Paenibacillus sp. PastM-3 Isolate Blattidae
40 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
41 3300060700 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_PP_b (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
42 3300060707 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Day0b (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
43 3300060751 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_LDPE_oats_a (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
44 8073624232 Bartonella sp. W8151 Isolate Apidae
45 2820479655 Unclassified Firmicutes Lab288P1bin77 Isolate Unclassified
46 2820518089 Unclassified Firmicutes Lab288P1bin27 Isolate Unclassified
47 2820713307 Unclassified Firmicutes Co191P1bin2 Isolate Unclassified
48 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
49 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
50 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
51 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
52 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
53 3300060759 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_PS_oats_a (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
54 649633028 Candidatus Blochmannia vafer BVAF Isolate Formicidae
55 8068953321 Bartonella apihabitans M0190 Isolate Apidae
56 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
57 2820303403 Unclassified Firmicutes Th196P1bin2 Isolate Unclassified
58 2820469612 Unclassified Firmicutes Lab288P1bin92 Isolate Unclassified
59 2820499546 Unclassified Firmicutes Lab288P1bin54 Isolate Unclassified
60 2820522177 Unclassified Firmicutes Lab288P1bin22 Isolate Unclassified
61 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
62 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
63 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
64 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
65 2834762790 Rickettsia fournieri AUS118 Isolate Unclassified
66 2852337885 Paenibacillus protaetiae FW100M-2 Isolate Scarabaeidae
67 2940380068 Paenibacillus sp. PastH-2 Isolate Blattidae
68 3300060752 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_LDPE_oats_c (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
69 8068944069 Bartonella choladocola W8125 Isolate Apidae
70 8068955631 Bartonella apihabitans M0280 Isolate Apidae
71 8073628750 Bartonella sp. W8167 Isolate Apidae
72 638341178 Rickettsia sibirica 246 Isolate Unclassified
73 2751185853 Bartonella apis BBC0178 Isolate Apidae
74 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
75 2820627938 Unclassified Firmicutes Emb289P1bin122 Isolate Unclassified
76 2820681712 Unclassified Firmicutes Co191P1bin84 Isolate Unclassified
77 2820693137 Unclassified Firmicutes Co191P1bin70 Isolate Unclassified
78 2998832964 Enterobacteriaceae endosymbiont of Plateumaris rustica PrusSym Isolate Chrysomelidae
79 3006667155 Streptomyces sp. SID9727 Isolate
80 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
81 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
82 2834540479 Leuconostoc citreum DmW_111 Isolate Drosophilidae
83 2890957088 Psychrobacillus lasiicapitis NEAU-3TGS17 Isolate Formicidae
84 2940386776 Paenibacillus sp. PastF-1 Isolate Blattidae
85 8073626464 Bartonella apis W8152 Isolate Apidae
86 640753044 Rickettsia bellii OSU 85-389 Isolate Ixodidae
87 2811995359 Rickettsia bellii An04 Isolate Ixodidae
88 2820592308 Unclassified Firmicutes Emb289P1bin71 Isolate Unclassified
89 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
90 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
91 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
92 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
93 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
94 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
95 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
96 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
97 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
98 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
99 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae
100 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
101 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
102 3300061798 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_HDPE_oats_a (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
103 8068950955 Bartonella apihabitans W8097 Isolate Apidae
104 8073621894 Bartonella apis W8099 Isolate Apidae
105 647533204 Rickettsia endosymbiont of Ixodes scapularis Isolate Ixodidae
106 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
107 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
108 2820309449 Unclassified Firmicutes Th196P1bin10 Isolate Unclassified
109 2820547636 Unclassified Firmicutes Lab288P1bin10 Isolate Unclassified
110 2820598593 Unclassified Firmicutes Emb289P1bin53 Isolate Unclassified
111 2998827396 Enterobacteriaceae endosymbiont of Plateumaris braccata PbraSym Isolate Chrysomelidae
112 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
113 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
114 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
115 2864955722 Sphingomonas kyeonggiensis S00224 Isolate Elmidae
116 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
117 3300060756 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_HDPE_oats_c (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
118 3300060770 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_HDPE_a (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
119 3300060896 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_PS_c (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
120 8068941587 Bartonella choladocola B10834H15 Isolate Apidae
121 8073619611 Bartonella apis B10834G6 Isolate Apidae
122 2751185858 Bartonella apis BBC0122 Isolate Apidae
123 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
124 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
125 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
126 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
127 2990166910 Pseudomonas typographi CA3A Isolate Curculionidae
128 2998834370 Enterobacteriaceae endosymbiont of Plateumaris consimilis PconSym Isolate Chrysomelidae
129 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
130 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
131 3300009457 Microbial communities of aphids from Cornus stolonifera in Ithaca, NY, USA - Anoecia oenotherae NM10041110_01 seqcov Metagenome
132 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_348205 3300042612 Bacteria 14127
2 Ga0590807_04206 3300060700 Unclassified 925
3 JGI24702J35022_10017940 3300002462 Bacteria 3863
4 JGI24700J35501_10930870 3300002508 Bacteria 30720
5 Ga0068305_10000012 3300005083 Bacteria 51331
6 Ga0160470_100206 3300012813 Bacteria 49427
7 Ga0466690_091502 3300042590 Bacteria 8728
8 Ga0466693_009054 3300042592 Bacteria 2260
9 Ga0466693_267272 3300042592 Bacteria 2626
10 Ga0466691_221500 3300042593 Bacteria 55284
11 Ga0466715_237445 3300042616 Bacteria 1533
12 Ga0466723_244218 3300042618 Bacteria 5803
13 Ga0466719_205774 3300042606 Bacteria 8168
14 Ga0123355_10002504 3300009826 Bacteria 26043
15 Ga0123353_10080390 3300010167 Bacteria 5242
16 Ga0466735_151151 3300042624 Bacteria 2735
17 Ga0466708_139820 3300042652 Unclassified 1285
18 Ga0466708_319318 3300042652 Bacteria 1612
19 Ga0102734_1000008 3300007129 Bacteria 101019
20 Ga0127656_102602 3300009453 Bacteria 31892
21 Ga0160443_101107 3300012848 Bacteria 10859
22 Ga0466694_042659 3300042594 Bacteria 7582
23 Ga0466694_252954 3300042594 Bacteria 25516
24 Ga0466723_011731 3300042618 Bacteria 6661
25 Ga0466726_006761 3300042619 Bacteria 1091
26 Ga0466706_183178 3300042599 Bacteria 15497
27 Ga0466722_186716 3300042609 Bacteria 18186
28 Ga0123355_10004281 3300009826 Bacteria 20749
29 Ga0123355_10202805 3300009826 Bacteria 2893
30 Ga0123355_10293895 3300009826 Bacteria 2225
31 Ga0123355_10348213 3300009826 Bacteria 1966
32 Ga0123353_10262690 3300010167 Bacteria 2665
33 Ga0466704_018089 3300042643 Bacteria 9895
34 Ga0466704_171773 3300042643 Bacteria 12329
35 Ga0466709_004973 3300042648 Bacteria 3832
36 Ga0590764_05991 3300060751 Unclassified 868
37 JGI24695J34938_10015236 3300002450 Bacteria 3950
38 JGI24695J34938_10060620 3300002450 Bacteria 1613
39 JGI24703J35330_11748782 3300002501 Bacteria 35580
40 Ga0074278_126004 3300005721 Bacteria 37893
41 Ga0074278_128945 3300005721 Unclassified 20671
42 Ga0415639_069103 3300038395 Bacteria 3809
43 Ga0466692_200113 3300042591 Bacteria 5542
44 Ga0466715_133762 3300042616 Bacteria 5052
45 Ga0466715_603110 3300042616 Bacteria 2790
46 Ga0466718_110994 3300042617 Unclassified 1356
47 Ga0123355_10362743 3300009826 Bacteria 1907
48 Ga0466735_096797 3300042624 Bacteria 3547
49 Ga0466708_134435 3300042652 Unclassified 1341
50 Ga0466732_147084 3300042656 Unclassified 3174
51 Ga0590766_03054 3300060752 Bacteria 2147
52 Ga0590772_00463 3300060756 Unclassified 4673
53 Ga0590794_00849 3300060770 Unclassified 3334
54 JGI24703J35330_11700534 3300002501 Bacteria 2021
55 Ga0160444_100035 3300012841 Bacteria 202992
56 Ga0160445_101259 3300012847 Bacteria 7605
57 Ga0466693_062886 3300042592 Bacteria 1490
58 Ga0466693_402515 3300042592 Bacteria 1654
59 Ga0466718_003975 3300042617 Bacteria 9930
60 Ga0466726_303193 3300042619 Bacteria 1159
61 Ga0466728_008248 3300042620 Bacteria 12629
62 Ga0466713_112604 3300042602 Bacteria 69095
63 Ga0466713_149396 3300042602 Bacteria 5017
64 Ga0123355_10010947 3300009826 Bacteria 13958
65 Ga0123355_10041971 3300009826 Bacteria 7447
66 Ga0123355_10059152 3300009826 Unclassified 6195
67 Ga0123355_10214534 3300009826 Bacteria 2781
68 Ga0123355_10268149 3300009826 Bacteria 2377
69 Ga0123356_10651881 3300010049 Bacteria 1220
70 Ga0123353_10814501 3300010167 Bacteria 1287
71 Ga0160442_100169 3300012806 Bacteria 59733
72 Ga0466735_210654 3300042624 Bacteria 1707
73 Ga0466703_011285 3300042636 Bacteria 13510
74 Ga0466708_292976 3300042652 Bacteria 1520
75 Ga0590770_06084 3300061798 Unclassified 907
76 Ga0074278_122003 3300005721 Bacteria 1106
77 Ga0127657_100003 3300009457 Bacteria 550482
78 Ga0123357_10000236 3300009784 Bacteria 52499
79 Ga0415639_009990 3300038395 Bacteria 22731
80 Ga0466692_185139 3300042591 Bacteria 5045
81 Ga0466694_408943 3300042594 Bacteria 1365
82 Ga0466712_216378 3300042614 Bacteria 1816
83 Ga0466723_210316 3300042618 Bacteria 3204
84 Ga0466713_005286 3300042602 Bacteria 50542
85 Ga0466713_047897 3300042602 Bacteria 9584
86 Ga0466714_029630 3300042603 Bacteria 5379
87 Ga0466698_267540 3300042610 Bacteria 2011
88 Ga0466698_446219 3300042610 Bacteria 2108
89 Ga0123355_10037191 3300009826 Bacteria 7913
90 Ga0466704_565798 3300042643 Bacteria 22995
91 Ga0466708_061888 3300042652 Bacteria 4354
92 Ga0466705_208486 3300042612 Bacteria 71494
93 Ga0590776_00425 3300060759 Unclassified 4690
94 WW0001_100148 3300002732 Bacteria 7473
95 Ga0074278_111728 3300005721 Bacteria 3361
96 Ga0466692_151188 3300042591 Bacteria 1656
97 Ga0466700_359380 3300042600 Bacteria 2365
98 Ga0466722_100908 3300042609 Bacteria 1804
99 Ga0466722_103405 3300042609 Bacteria 12737
100 Ga0466722_117124 3300042609 Bacteria 1641
101 Ga0123353_10805913 3300010167 Bacteria 1296
102 Ga0466730_071217 3300042625 Bacteria 1174
103 Ga0466727_325530 3300042655 Bacteria 1875
104 Ga0466705_210910 3300042612 Bacteria 10132
105 Ga0590811_02006 3300060704 Bacteria 2170
106 Ga0590816_06967 3300060707 Unclassified 2028
107 Ga0590775_03472 3300060896 Bacteria 2348
108 JGI24700J35501_10927909 3300002508 Bacteria 7168
109 JGI24700J35501_10930889 3300002508 Bacteria 34606
110 Ga0068305_10000253 3300005083 Bacteria 49207
111 Ga0074278_115937 3300005721 Bacteria 8469
112 Ga0264413_145650 3300024493 Bacteria 1814
113 Ga0466706_019380 3300042599 Bacteria 325727
114 Ga0466721_230156 3300042608 Bacteria 21988
115 Ga0123355_10269818 3300009826 Bacteria 2366
116 Ga0123355_10430032 3300009826 Bacteria 1680
117 Ga0466725_081938 3300042654 Bacteria 5640
118 Ga0466657_147637 3300042582 Bacteria 1269
119 Ga0466690_012460 3300042590 Bacteria 15225
120 Ga0466692_115206 3300042591 Bacteria 8018
121 Ga0466694_332883 3300042594 Bacteria 1430
122 Ga0466711_305093 3300042615 Bacteria 15838
123 Ga0466718_033109 3300042617 Bacteria 11387
124 Ga0466718_130488 3300042617 Bacteria 3267
125 Ga0466726_140145 3300042619 Bacteria 2760
126 Ga0466700_089307 3300042600 Bacteria 2392
127 Ga0466719_281488 3300042606 Bacteria 1332
128 Ga0123357_10153451 3300009784 Bacteria 2786
129 Ga0123355_10017057 3300009826 Bacteria 11464
130 Ga0123355_10107660 3300009826 Bacteria 4366
131 Ga0123355_10125009 3300009826 Bacteria 3977
132 Ga0123355_10458974 3300009826 Bacteria 1600
133 Ga0123353_10017189 3300010167 Bacteria 10614
134 Ga0123353_10123576 3300010167 Bacteria 4160
135 Ga0123353_10858695 3300010167 Bacteria 1243
136 Ga0466734_129545 3300042623 Bacteria 1670
137 Ga0466709_140130 3300042648 Bacteria 1405

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 58 281 0.96
PF00106 adh_short short chain dehydrogenase 50 234 0.95
PF08659 KR KR domain 51 196 0.87

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.