Protein Family IF07787
Metagenome
Isolate
103
Members
37
Samples
98
Scaffolds
339.54
Avg Length
Representative Sequence
- ID
- 3300042616|Ga0466715_410220|Ga0466715_410220_528_1595
- Length
- 355 aa
- Sequence
- MSQPESFSLEKTTLGSTNLEVTRCAFGALPIQRISFGESVALLRAAYEGGINFYDTAHGYYDSEEKIGAALGGERERVVIASKAPGLDGDLYRRQLDESLRRMRTDYIDVFQFHLAKKVHRPGEPDGLYEAALGAKESGKIRHIGITTHRIGVAMEAAGSGLYETVQFPLSYLSNPGDLELVKACRENGVGLIAMKALSGGLITDARLAWLFMRQYDNVVPIWGLQRMSELEEFLSFERNHPEWTGELREKITRDKAELSDNFCRGCGYCLPCAVNIEVNWVARMPQVLRRMKAEEFLTPEWRGKMKLAEDCVNCGACKSRCPYELDPPAMIAAAYEDYKNFAADWDASRQKARA
Sample Types
Isolate
4.8%
Metagenome
95.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
45.7%
Kalotermitidae
25.7%
Unclassified
17.1%
Termopsidae
5.7%
Passalidae
2.9%
Rhinotermitidae
2.9%
Taxonomy
Archaea
1
Bacteria
90
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 2 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 3 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 7 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 8 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 9 | 2820007728 | Unclassified Synergistetes Lab288P3bin114 | Isolate | Unclassified |
| 10 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 11 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 12 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 13 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 14 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 15 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 16 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 17 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 18 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 19 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 20 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 21 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 22 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 23 | 2228664001 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4a from Florida USA | Metagenome | Termitidae |
| 24 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 25 | 2820347164 | Unclassified Firmicutes Nt197P3bin58 | Isolate | Unclassified |
| 26 | 2820501819 | Unclassified Firmicutes Lab288P1bin51 | Isolate | Unclassified |
| 27 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 28 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 29 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 30 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 31 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 32 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 33 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 34 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 35 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 36 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 37 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0415639_049295 | 3300038395 | Bacteria | 9079 |
| 2 | Ga0415639_105311 | 3300038395 | Bacteria | 6861 |
| 3 | Ga0466699_250841 | 3300042597 | Bacteria | 13968 |
| 4 | Ga0123355_10131612 | 3300009826 | Unclassified | 3853 |
| 5 | Ga0123353_10247025 | 3300010167 | Unclassified | 2767 |
| 6 | Ga0466705_100848 | 3300042612 | Bacteria | 5872 |
| 7 | 2230929972 | 2228664001 | Bacteria | 6945 |
| 8 | Ga0466720_063730 | 3300042607 | Bacteria | 6174 |
| 9 | Ga0466720_146312 | 3300042607 | Bacteria | 8817 |
| 10 | Ga0466698_215730 | 3300042610 | Bacteria | 24389 |
| 11 | Ga0466711_124009 | 3300042615 | Bacteria | 11168 |
| 12 | Ga0466718_070153 | 3300042617 | Bacteria | 15513 |
| 13 | Ga0466718_131450 | 3300042617 | Bacteria | 2668 |
| 14 | Ga0466733_005493 | 3300042659 | Bacteria | 2965 |
| 15 | Ga0264413_101301 | 3300024493 | Bacteria | 53125 |
| 16 | Ga0415639_033269 | 3300038395 | Bacteria | 9179 |
| 17 | Ga0415639_104798 | 3300038395 | Unclassified | 3210 |
| 18 | Ga0123355_10338398 | 3300009826 | Bacteria | 2008 |
| 19 | Ga0123354_10019786 | 3300010882 | Bacteria | 10573 |
| 20 | Ga0072940_1007264 | 3300005200 | Bacteria | 4908 |
| 21 | Ga0466720_206616 | 3300042607 | Bacteria | 2731 |
| 22 | Ga0466720_233125 | 3300042607 | Bacteria | 4327 |
| 23 | Ga0466711_506134 | 3300042615 | Bacteria | 3761 |
| 24 | Ga0264413_114824 | 3300024493 | Bacteria | 5432 |
| 25 | Ga0466694_022308 | 3300042594 | Bacteria | 5478 |
| 26 | Ga0466699_072196 | 3300042597 | Bacteria | 50938 |
| 27 | Ga0123355_10033487 | 3300009826 | Bacteria | 8347 |
| 28 | Ga0466705_337250 | 3300042612 | Bacteria | 4436 |
| 29 | IMNBL1DRAFT_c0000300 | 3300000062 | Bacteria | 42087 |
| 30 | AustNasuHG_c1000171 | 3300000089 | Bacteria | 21002 |
| 31 | Ga0072940_1003165 | 3300005200 | Bacteria | 16443 |
| 32 | Ga0466720_017369 | 3300042607 | Bacteria | 21503 |
| 33 | Ga0466720_056582 | 3300042607 | Unclassified | 7113 |
| 34 | Ga0466720_080159 | 3300042607 | Bacteria | 2889 |
| 35 | Ga0466711_323549 | 3300042615 | Bacteria | 14617 |
| 36 | Ga0466715_616988 | 3300042616 | Unclassified | 1899 |
| 37 | Ga0466732_188695 | 3300042656 | Bacteria | 4780 |
| 38 | Ga0466732_223663 | 3300042656 | Bacteria | 47450 |
| 39 | Ga0466699_148187 | 3300042597 | Bacteria | 8155 |
| 40 | Ga0466720_022542 | 3300042607 | Unclassified | 1311 |
| 41 | Ga0466720_029171 | 3300042607 | Unclassified | 1249 |
| 42 | Ga0466715_410220 | 3300042616 | Bacteria | 1785 |
| 43 | Ga0466718_021742 | 3300042617 | Bacteria | 6394 |
| 44 | Ga0466718_033903 | 3300042617 | Bacteria | 2276 |
| 45 | Ga0466732_212780 | 3300042656 | Bacteria | 1387 |
| 46 | Ga0466699_053886 | 3300042597 | Bacteria | 44491 |
| 47 | Ga0466699_171036 | 3300042597 | Unclassified | 1983 |
| 48 | Ga0123353_10703299 | 3300010167 | Bacteria | 1418 |
| 49 | Ga0123354_10255344 | 3300010882 | Bacteria | 1764 |
| 50 | IMNBL1DRAFT_c0002771 | 3300000062 | Bacteria | 11900 |
| 51 | IMNBL1DRAFT_c0003016 | 3300000062 | Bacteria | 11157 |
| 52 | JGI24695J34938_10025493 | 3300002450 | Bacteria | 2826 |
| 53 | Ga0466716_366048 | 3300042605 | Bacteria | 1799 |
| 54 | Ga0466720_123026 | 3300042607 | Bacteria | 8873 |
| 55 | Ga0466711_482766 | 3300042615 | Bacteria | 2032 |
| 56 | Ga0466718_030000 | 3300042617 | Bacteria | 2801 |
| 57 | Ga0466726_291746 | 3300042619 | Bacteria | 2619 |
| 58 | Ga0466728_172641 | 3300042620 | Bacteria | 34908 |
| 59 | Ga0466732_060641 | 3300042656 | Bacteria | 2164 |
| 60 | Ga0466694_078031 | 3300042594 | Bacteria | 1170 |
| 61 | Ga0466696_139212 | 3300042596 | Bacteria | 5166 |
| 62 | Ga0466699_047498 | 3300042597 | Bacteria | 13597 |
| 63 | Ga0466699_147966 | 3300042597 | Bacteria | 13012 |
| 64 | Ga0466699_162843 | 3300042597 | Bacteria | 6585 |
| 65 | Ga0123355_10065545 | 3300009826 | Unclassified | 5850 |
| 66 | Ga0466729_199277 | 3300042621 | Bacteria | 6007 |
| 67 | Ga0466720_012424 | 3300042607 | Bacteria | 15798 |
| 68 | Ga0466720_018543 | 3300042607 | Bacteria | 131979 |
| 69 | Ga0466720_030465 | 3300042607 | Bacteria | 19413 |
| 70 | Ga0466720_046734 | 3300042607 | Bacteria | 5443 |
| 71 | Ga0466732_037934 | 3300042656 | Bacteria | 15040 |
| 72 | Ga0466699_084882 | 3300042597 | Unclassified | 5193 |
| 73 | Ga0123356_10000325 | 3300010049 | Bacteria | 54913 |
| 74 | Ga0466729_250396 | 3300042621 | Bacteria | 5736 |
| 75 | Ga0466703_102358 | 3300042636 | Archaea | 2229 |
| 76 | Ga0466708_358966 | 3300042652 | Bacteria | 14857 |
| 77 | Ga0466727_143303 | 3300042655 | Bacteria | 3069 |
| 78 | AustNasuHG_c1012791 | 3300000089 | Unclassified | 2891 |
| 79 | AustNasuHG_c1017026 | 3300000089 | Bacteria | 2423 |
| 80 | JGI24695J34938_10020013 | 3300002450 | Bacteria | 3302 |
| 81 | Ga0072940_1004918 | 3300005200 | Bacteria | 32026 |
| 82 | Ga0466720_023164 | 3300042607 | Bacteria | 11554 |
| 83 | Ga0466720_030798 | 3300042607 | Bacteria | 5285 |
| 84 | Ga0466720_095243 | 3300042607 | Bacteria | 1843 |
| 85 | Ga0466720_130092 | 3300042607 | Bacteria | 12794 |
| 86 | Ga0466720_182937 | 3300042607 | Bacteria | 5637 |
| 87 | Ga0466718_002394 | 3300042617 | Unclassified | 1435 |
| 88 | Ga0466718_012908 | 3300042617 | Bacteria | 13643 |
| 89 | Ga0466699_228884 | 3300042597 | Bacteria | 6116 |
| 90 | Ga0466699_383788 | 3300042597 | Bacteria | 1615 |
| 91 | Ga0466699_387023 | 3300042597 | Bacteria | 13572 |
| 92 | Ga0123356_10314491 | 3300010049 | Bacteria | 1676 |
| 93 | Ga0072941_1191166 | 3300005201 | Bacteria | 2714 |
| 94 | Ga0466713_152072 | 3300042602 | Bacteria | 2002 |
| 95 | Ga0466719_562334 | 3300042606 | Bacteria | 1760 |
| 96 | Ga0466720_107313 | 3300042607 | Bacteria | 24749 |
| 97 | Ga0466720_137070 | 3300042607 | Bacteria | 34404 |
| 98 | Ga0466718_017130 | 3300042617 | Bacteria | 4123 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.