Protein Family IF07758
Metagenome
Isolate
214
Members
89
Samples
173
Scaffolds
200.31
Avg Length
Representative Sequence
- ID
- 3300042616|Ga0466715_309498|Ga0466715_309498_632_1324
- Length
- 230 aa
- Sequence
- LIDYDYQQFEITCFHVAKKDFFLKAKHSRINLTMDIDFQKTDGLVPAIIQDVYTSKVLMLGFMNAEALQKTQETGQVTFYSRSKKRLWTKGEESGNFLNVVSVHADCDKDTLLIKVKPVGVVCHTGADTCWNESNDAGFAFLNYLQEFIKIRYDEMPEGSYTTSLFDQGVNRMAQKVGEEAVETVIEAVNGTDEGFLYEASDLLYHLIVLLRSKGYSLDDLGRELKKRHK
Sample Types
Isolate
19.2%
Metagenome
80.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
27.9%
Termitidae
19.8%
Kalotermitidae
16.3%
Unclassified
10.5%
Rhinotermitidae
7.0%
Aphididae
5.8%
Hydrophilidae
3.5%
Termopsidae
3.5%
Passalidae
2.3%
Hodotermitidae
1.2%
Drosophilidae
1.2%
Culicidae
1.2%
Taxonomy
Archaea
0
Bacteria
208
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2558860197 | Buchnera aphidicola F009 | Isolate | Aphididae |
| 2 | 2820750388 | Unclassified Bacteroidetes Nt197P3bin50 | Isolate | Unclassified |
| 3 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 4 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2558860194 | Buchnera aphidicola USDA | Isolate | Aphididae |
| 12 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 13 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 14 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 15 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 16 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 17 | 2558860196 | Buchnera aphidicola W106 | Isolate | Aphididae |
| 18 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 19 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 20 | 2998907766 | Penaeicola halotolerans LMIT005 | Isolate | |
| 21 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 22 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 23 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 24 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 25 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 26 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 27 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 28 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 29 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 30 | 3300009477 | Microbial communities of aphids from Cirsium sp. in Ottawa, Ontario, CA - Brachycaudus cardui CNC#HEM061370 seqcov | Metagenome | |
| 31 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 32 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 33 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 34 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 35 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 36 | 2558860195 | Buchnera aphidicola G002 | Isolate | Aphididae |
| 37 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 38 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 39 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 40 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 41 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 42 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 43 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 44 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 45 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 46 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 47 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 48 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 49 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 50 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 51 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 52 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 53 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 54 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 55 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 56 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 57 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 58 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 59 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 60 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 61 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 62 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 63 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 64 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 65 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 66 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 67 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 68 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 69 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 70 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 71 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 72 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 73 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 74 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 75 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 76 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 77 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 78 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 79 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 80 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 81 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 82 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 83 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 84 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 85 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 86 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 87 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 88 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 89 | 3300038942 | Host-associated microbial communities from haemolymph of Banana aphid from Africa - Madagascar | Metagenome | Aphididae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_048881 | 3300042659 | Bacteria | 1924 |
| 2 | Ga0466733_169232 | 3300042659 | Unclassified | 1271 |
| 3 | Ga0466701_079535 | 3300042598 | Bacteria | 72629 |
| 4 | Ga0466700_075704 | 3300042600 | Bacteria | 26374 |
| 5 | Ga0466714_028687 | 3300042603 | Bacteria | 1375 |
| 6 | Ga0466716_145207 | 3300042605 | Bacteria | 1463 |
| 7 | Ga0466719_491579 | 3300042606 | Bacteria | 7343 |
| 8 | Ga0466705_451695 | 3300042612 | Bacteria | 2042 |
| 9 | Ga0466711_074652 | 3300042615 | Bacteria | 14018 |
| 10 | Ga0466703_019858 | 3300042636 | Bacteria | 25850 |
| 11 | Ga0466703_335745 | 3300042636 | Bacteria | 5577 |
| 12 | Ga0466725_198740 | 3300042654 | Bacteria | 1369 |
| 13 | Ga0466692_105849 | 3300042591 | Bacteria | 2420 |
| 14 | Ga0466692_165801 | 3300042591 | Bacteria | 1282 |
| 15 | Ga0466696_368291 | 3300042596 | Bacteria | 2452 |
| 16 | Ga0123357_10011226 | 3300009784 | Bacteria | 11468 |
| 17 | Ga0123357_10157682 | 3300009784 | Bacteria | 2732 |
| 18 | Ga0123354_10502548 | 3300010882 | Bacteria | 944 |
| 19 | Ga0466705_080072 | 3300042612 | Bacteria | 6630 |
| 20 | Ga0466705_098329 | 3300042612 | Bacteria | 3535 |
| 21 | Ga0466713_046146 | 3300042602 | Bacteria | 21457 |
| 22 | Ga0466719_397684 | 3300042606 | Bacteria | 1500 |
| 23 | Ga0466722_026149 | 3300042609 | Bacteria | 42543 |
| 24 | Ga0466705_513389 | 3300042612 | Bacteria | 1249 |
| 25 | Ga0466715_142198 | 3300042616 | Bacteria | 18676 |
| 26 | Ga0466715_309498 | 3300042616 | Bacteria | 1653 |
| 27 | Ga0466715_480711 | 3300042616 | Bacteria | 22723 |
| 28 | Ga0466726_030520 | 3300042619 | Bacteria | 4818 |
| 29 | Ga0466726_433746 | 3300042619 | Bacteria | 20034 |
| 30 | Ga0466727_226865 | 3300042655 | Bacteria | 3842 |
| 31 | 2227512808 | 2225789004 | Bacteria | 693 |
| 32 | IMNBL1DRAFT_c0000303 | 3300000062 | Bacteria | 41914 |
| 33 | Ga0127522_100011 | 3300009477 | Bacteria | 644448 |
| 34 | Ga0123357_10105389 | 3300009784 | Bacteria | 3617 |
| 35 | Ga0123357_10192259 | 3300009784 | Bacteria | 2348 |
| 36 | Ga0123356_10617196 | 3300010049 | Bacteria | 1250 |
| 37 | Ga0123354_10203287 | 3300010882 | Bacteria | 2169 |
| 38 | Ga0466733_080268 | 3300042659 | Unclassified | 3609 |
| 39 | Ga0466706_212921 | 3300042599 | Bacteria | 20425 |
| 40 | Ga0466706_280127 | 3300042599 | Bacteria | 16167 |
| 41 | Ga0466713_078988 | 3300042602 | Bacteria | 2565 |
| 42 | Ga0466716_471390 | 3300042605 | Bacteria | 4302 |
| 43 | Ga0466698_266574 | 3300042610 | Bacteria | 2046 |
| 44 | Ga0466711_238034 | 3300042615 | Bacteria | 37187 |
| 45 | Ga0466711_249317 | 3300042615 | Bacteria | 18334 |
| 46 | Ga0466723_021356 | 3300042618 | Bacteria | 5349 |
| 47 | Ga0466726_295675 | 3300042619 | Bacteria | 3137 |
| 48 | Ga0466728_016956 | 3300042620 | Unclassified | 25210 |
| 49 | Ga0466729_215081 | 3300042621 | Unclassified | 1536 |
| 50 | Ga0466703_008757 | 3300042636 | Bacteria | 6577 |
| 51 | Ga0466703_020799 | 3300042636 | Bacteria | 26501 |
| 52 | Ga0466703_179942 | 3300042636 | Bacteria | 9716 |
| 53 | Ga0466703_354789 | 3300042636 | Bacteria | 4683 |
| 54 | Ga0466704_442642 | 3300042643 | Bacteria | 41618 |
| 55 | Ga0466727_144340 | 3300042655 | Bacteria | 5027 |
| 56 | Ga0466727_229282 | 3300042655 | Bacteria | 1605 |
| 57 | Ga0466727_287969 | 3300042655 | Bacteria | 9196 |
| 58 | IMNBL1DRAFT_c0005773 | 3300000062 | Bacteria | 6961 |
| 59 | JGI24699J35502_11134210 | 3300002509 | Bacteria | 59774 |
| 60 | Ga0068305_10010571 | 3300005083 | Bacteria | 68461 |
| 61 | Ga0160448_109578 | 3300012854 | Bacteria | 2119 |
| 62 | Ga0120204_000112 | 3300038942 | Bacteria | 3897 |
| 63 | Ga0466690_049656 | 3300042590 | Bacteria | 6090 |
| 64 | Ga0123357_10189477 | 3300009784 | Unclassified | 2375 |
| 65 | Ga0123354_10004885 | 3300010882 | Bacteria | 19219 |
| 66 | Ga0123354_10359539 | 3300010882 | Bacteria | 1285 |
| 67 | Ga0466733_047834 | 3300042659 | Bacteria | 69270 |
| 68 | Ga0466713_099183 | 3300042602 | Bacteria | 118109 |
| 69 | Ga0466716_129240 | 3300042605 | Bacteria | 11148 |
| 70 | Ga0466719_370215 | 3300042606 | Bacteria | 6567 |
| 71 | Ga0466711_165558 | 3300042615 | Bacteria | 2216 |
| 72 | Ga0466711_234030 | 3300042615 | Bacteria | 4939 |
| 73 | Ga0466715_194603 | 3300042616 | Bacteria | 47231 |
| 74 | Ga0466728_019567 | 3300042620 | Bacteria | 33080 |
| 75 | Ga0466729_007879 | 3300042621 | Bacteria | 30241 |
| 76 | Ga0466734_161395 | 3300042623 | Bacteria | 1138 |
| 77 | Ga0466735_044121 | 3300042624 | Bacteria | 6045 |
| 78 | Ga0466735_071826 | 3300042624 | Bacteria | 2341 |
| 79 | Ga0466735_112599 | 3300042624 | Bacteria | 6718 |
| 80 | Ga0466735_160562 | 3300042624 | Bacteria | 1820 |
| 81 | Ga0466703_199268 | 3300042636 | Bacteria | 4213 |
| 82 | Ga0466704_433307 | 3300042643 | Bacteria | 1295 |
| 83 | Ga0466708_008222 | 3300042652 | Bacteria | 18738 |
| 84 | Ga0466708_057780 | 3300042652 | Unclassified | 1437 |
| 85 | 2227122482 | 2225789004 | Bacteria | 9133 |
| 86 | Ga0104045_1075598 | 3300007085 | Bacteria | 1897 |
| 87 | Ga0123357_10001078 | 3300009784 | Bacteria | 28159 |
| 88 | Ga0466690_394310 | 3300042590 | Bacteria | 2729 |
| 89 | Ga0466691_212540 | 3300042593 | Bacteria | 6238 |
| 90 | Ga0466696_316966 | 3300042596 | Bacteria | 3878 |
| 91 | Ga0466699_254412 | 3300042597 | Bacteria | 3166 |
| 92 | Ga0123354_10005281 | 3300010882 | Bacteria | 18726 |
| 93 | Ga0160465_100068 | 3300012803 | Bacteria | 115656 |
| 94 | Ga0466706_027435 | 3300042599 | Bacteria | 1700 |
| 95 | Ga0466706_045487 | 3300042599 | Bacteria | 46225 |
| 96 | Ga0466706_056516 | 3300042599 | Bacteria | 19262 |
| 97 | Ga0466700_136206 | 3300042600 | Bacteria | 6703 |
| 98 | Ga0466707_083062 | 3300042601 | Bacteria | 7090 |
| 99 | Ga0466707_161564 | 3300042601 | Bacteria | 10752 |
| 100 | Ga0466707_243595 | 3300042601 | Bacteria | 19927 |
| 101 | Ga0466716_337513 | 3300042605 | Bacteria | 4979 |
| 102 | Ga0466722_004782 | 3300042609 | Bacteria | 5325 |
| 103 | Ga0466723_209820 | 3300042618 | Bacteria | 2222 |
| 104 | Ga0466735_096691 | 3300042624 | Bacteria | 3494 |
| 105 | Ga0466730_024175 | 3300042625 | Bacteria | 1196 |
| 106 | Ga0466703_151702 | 3300042636 | Bacteria | 27425 |
| 107 | Ga0466704_249256 | 3300042643 | Bacteria | 4672 |
| 108 | Ga0466709_241178 | 3300042648 | Bacteria | 10948 |
| 109 | Ga0466708_135461 | 3300042652 | Bacteria | 17966 |
| 110 | Ga0466708_219364 | 3300042652 | Bacteria | 19223 |
| 111 | Ga0466725_176145 | 3300042654 | Bacteria | 20828 |
| 112 | JGI24699J35502_11134170 | 3300002509 | Bacteria | 43760 |
| 113 | Ga0466691_005883 | 3300042593 | Bacteria | 6146 |
| 114 | Ga0466691_052189 | 3300042593 | Bacteria | 7738 |
| 115 | Ga0466691_058338 | 3300042593 | Bacteria | 8322 |
| 116 | Ga0123357_10010972 | 3300009784 | Bacteria | 11572 |
| 117 | Ga0123357_10194820 | 3300009784 | Bacteria | 2324 |
| 118 | Ga0123357_10198963 | 3300009784 | Bacteria | 2286 |
| 119 | Ga0123354_10247469 | 3300010882 | Bacteria | 1816 |
| 120 | Ga0466705_338591 | 3300042612 | Bacteria | 1022 |
| 121 | Ga0466701_029245 | 3300042598 | Bacteria | 16273 |
| 122 | Ga0466713_140874 | 3300042602 | Bacteria | 46073 |
| 123 | Ga0466711_509002 | 3300042615 | Bacteria | 4697 |
| 124 | Ga0466728_098038 | 3300042620 | Bacteria | 10918 |
| 125 | Ga0466703_305950 | 3300042636 | Bacteria | 6280 |
| 126 | Ga0466704_406540 | 3300042643 | Bacteria | 3153 |
| 127 | Ga0466709_102522 | 3300042648 | Bacteria | 172874 |
| 128 | Ga0466708_272774 | 3300042652 | Bacteria | 6152 |
| 129 | Ga0123357_10001255 | 3300009784 | Bacteria | 26695 |
| 130 | Ga0466690_385570 | 3300042590 | Bacteria | 20353 |
| 131 | Ga0466690_407203 | 3300042590 | Bacteria | 13121 |
| 132 | Ga0466694_245688 | 3300042594 | Bacteria | 1237 |
| 133 | Ga0466696_040606 | 3300042596 | Bacteria | 10155 |
| 134 | Ga0466701_009475 | 3300042598 | Bacteria | 1406 |
| 135 | Ga0466697_258751 | 3300042611 | Bacteria | 1014 |
| 136 | Ga0466705_191911 | 3300042612 | Bacteria | 3296 |
| 137 | Ga0466701_050189 | 3300042598 | Bacteria | 5312 |
| 138 | Ga0466706_058332 | 3300042599 | Bacteria | 9971 |
| 139 | Ga0466706_252336 | 3300042599 | Bacteria | 30022 |
| 140 | Ga0466707_044264 | 3300042601 | Bacteria | 2534 |
| 141 | Ga0466707_129085 | 3300042601 | Bacteria | 1630 |
| 142 | Ga0466707_191430 | 3300042601 | Bacteria | 1572 |
| 143 | Ga0466713_035110 | 3300042602 | Bacteria | 2140 |
| 144 | Ga0466713_044454 | 3300042602 | Bacteria | 40764 |
| 145 | Ga0466719_206932 | 3300042606 | Bacteria | 1037 |
| 146 | Ga0466722_036334 | 3300042609 | Bacteria | 4666 |
| 147 | Ga0466712_150496 | 3300042614 | Bacteria | 2604 |
| 148 | Ga0466711_384472 | 3300042615 | Bacteria | 1653 |
| 149 | Ga0466715_020643 | 3300042616 | Bacteria | 1514 |
| 150 | Ga0466728_234203 | 3300042620 | Bacteria | 10903 |
| 151 | Ga0466703_128842 | 3300042636 | Bacteria | 11202 |
| 152 | Ga0466709_309968 | 3300042648 | Bacteria | 3083 |
| 153 | IMNBL1DRAFT_c0000411 | 3300000062 | Bacteria | 36219 |
| 154 | Ga0466657_078928 | 3300042582 | Bacteria | 14769 |
| 155 | Ga0123357_10290613 | 3300009784 | Bacteria | 1670 |
| 156 | Ga0466705_041128 | 3300042612 | Bacteria | 36311 |
| 157 | Ga0466707_022169 | 3300042601 | Bacteria | 38620 |
| 158 | Ga0466707_282942 | 3300042601 | Bacteria | 1759 |
| 159 | Ga0466713_007344 | 3300042602 | Bacteria | 13469 |
| 160 | Ga0466714_010457 | 3300042603 | Bacteria | 1142 |
| 161 | Ga0466715_066493 | 3300042616 | Bacteria | 33961 |
| 162 | Ga0466715_117427 | 3300042616 | Bacteria | 8309 |
| 163 | Ga0466728_176748 | 3300042620 | Bacteria | 5808 |
| 164 | Ga0466729_177579 | 3300042621 | Bacteria | 9451 |
| 165 | Ga0466735_038852 | 3300042624 | Bacteria | 6784 |
| 166 | Ga0466704_107169 | 3300042643 | Bacteria | 11926 |
| 167 | 2227606565 | 2225789004 | Bacteria | 2294 |
| 168 | Ga0466690_287469 | 3300042590 | Bacteria | 1746 |
| 169 | Ga0466691_036654 | 3300042593 | Bacteria | 14964 |
| 170 | Ga0466696_036365 | 3300042596 | Bacteria | 16935 |
| 171 | Ga0123356_10858064 | 3300010049 | Bacteria | 1079 |
| 172 | Ga0123356_11060295 | 3300010049 | Bacteria | 980 |
| 173 | Ga0123354_10000328 | 3300010882 | Bacteria | 44060 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.