Protein Family IF07704
Metagenome
Isolate
346
Members
122
Samples
283
Scaffolds
448.53
Avg Length
Representative Sequence
- ID
- 3300042616|Ga0466715_210726|Ga0466715_210726_981_2477
- Length
- 498 aa
- Sequence
- LVDWDYSGGFGDCDFENEVIDYEQNMIMINIKKKENKGINLAEFMPSVLRRLVVLGAGESGAGAAVLAKKKGFDVFVSDLSTIKDKYKEILERYEIPYEEGFHTEEKILNANEVIKSPGIPDKAPIVKKLTAQNTPVISEIEFAGRYTNAKTICITGSNGKTTTTMLTYHILKSAGLNVGLAGNVGESFALQVAEQDYDYYVIELSSFQLDGMYDFRADIAVLLNITPDHLDRYNYEMQNYVDAKMRIIQNQTAADAFIFWNGDPTVKLRITNYGLRNDKKLCPALYPFAQFKEEGVIAYTENKQIIINTPKGNFNMEEELVALTGTHNLYNSLAAGIAAKLLDIKNEDIRRSLSDFKGVEHRLEKVAKVRGVEYINDSKATNVNSTWYALQSMKTPVVLILGGTDKGNDYREIEALVKEKCRALIYLGVDNSKLHKFFDGKVSQTTEAHSMEEAVSKAYDIAETGDTVLLSPCCASFDLFENYEDRGKQFKHYVRKL
Sample Types
Isolate
18.2%
Metagenome
81.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
25.2%
Termitidae
18.5%
Kalotermitidae
11.8%
Unclassified
10.9%
Elmidae
7.6%
Culicidae
5.0%
Rhinotermitidae
4.2%
Termopsidae
3.4%
Passalidae
2.5%
Daphniidae
1.7%
Hydrophilidae
1.7%
Tenebrionidae
1.7%
Drosophilidae
1.7%
Cambaridae
1.7%
Hodotermitidae
0.8%
Kiwaidae
0.8%
Armadillidiidae
0.8%
Taxonomy
Archaea
0
Bacteria
343
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 2 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 3 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 4 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 5 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 6 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 7 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 8 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 9 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 10 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 11 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 12 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 13 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 14 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 15 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 16 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 17 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 18 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 19 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 20 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 21 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 22 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 23 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 24 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 25 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 26 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 27 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 28 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 29 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 30 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 31 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 32 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 33 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 34 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 35 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 36 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 37 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 38 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 39 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 40 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 41 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 42 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 43 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 44 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 45 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 46 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 47 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 48 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 49 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 50 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 51 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 52 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 53 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 54 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 55 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 56 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 57 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 58 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 59 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 60 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 61 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 62 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 63 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 64 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 65 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 66 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 67 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 68 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 69 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 70 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 71 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 72 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 73 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 74 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 75 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 76 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 77 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 78 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 79 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 80 | 2921902974 | Chryseobacterium sp. cx-624 | Isolate | Cambaridae |
| 81 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 82 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 83 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 84 | 3300013007 | Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts | Metagenome | Kiwaidae |
| 85 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 86 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 87 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 88 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 89 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 90 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 91 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 92 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 93 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 94 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 95 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 96 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 97 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 98 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 99 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 100 | 2820781750 | Unclassified Bacteroidetes Emb289P3bin89 | Isolate | Unclassified |
| 101 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 102 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 103 | 2864891731 | Chryseobacterium defluvii S00151 | Isolate | Elmidae |
| 104 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 105 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 106 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 107 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 108 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 109 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 110 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 111 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 112 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 113 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 114 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 115 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 116 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 117 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 118 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 119 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 120 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 121 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 122 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_004521 | 3300042612 | Bacteria | 9564 |
| 2 | Ga0466705_024977 | 3300042612 | Bacteria | 9985 |
| 3 | Ga0466733_022772 | 3300042659 | Bacteria | 146320 |
| 4 | Ga0466733_181724 | 3300042659 | Bacteria | 66237 |
| 5 | Ga0466711_063536 | 3300042615 | Bacteria | 6062 |
| 6 | Ga0466711_219426 | 3300042615 | Bacteria | 1739 |
| 7 | Ga0466715_089480 | 3300042616 | Bacteria | 17534 |
| 8 | Ga0466726_364377 | 3300042619 | Bacteria | 2297 |
| 9 | Ga0466726_383047 | 3300042619 | Bacteria | 3103 |
| 10 | Ga0466728_393205 | 3300042620 | Bacteria | 4205 |
| 11 | Ga0466730_071786 | 3300042625 | Bacteria | 741189 |
| 12 | Ga0466703_102327 | 3300042636 | Bacteria | 38440 |
| 13 | Ga0466703_262959 | 3300042636 | Bacteria | 29096 |
| 14 | Ga0466704_139994 | 3300042643 | Bacteria | 7248 |
| 15 | Ga0466709_137811 | 3300042648 | Bacteria | 185438 |
| 16 | Ga0466708_095594 | 3300042652 | Bacteria | 24720 |
| 17 | Ga0466708_196684 | 3300042652 | Bacteria | 22308 |
| 18 | Ga0466725_202265 | 3300042654 | Bacteria | 20853 |
| 19 | Ga0466727_321137 | 3300042655 | Bacteria | 3868 |
| 20 | Ga0123356_10162645 | 3300010049 | Bacteria | 2232 |
| 21 | Ga0123353_10556308 | 3300010167 | Bacteria | 1653 |
| 22 | Ga0123354_10010069 | 3300010882 | Bacteria | 14523 |
| 23 | Ga0123354_10030009 | 3300010882 | Bacteria | 8545 |
| 24 | Ga0466706_137590 | 3300042599 | Bacteria | 25056 |
| 25 | Ga0466707_347366 | 3300042601 | Bacteria | 6060 |
| 26 | Ga0466713_021377 | 3300042602 | Bacteria | 32539 |
| 27 | Ga0466713_089753 | 3300042602 | Bacteria | 35618 |
| 28 | Ga0466714_039286 | 3300042603 | Bacteria | 40419 |
| 29 | Ga0466719_124438 | 3300042606 | Bacteria | 5095 |
| 30 | Ga0466719_176700 | 3300042606 | Bacteria | 1945 |
| 31 | Ga0466722_062608 | 3300042609 | Bacteria | 10750 |
| 32 | Ga0466722_143739 | 3300042609 | Bacteria | 19742 |
| 33 | 2227066935 | 2225789003 | Unclassified | 3148 |
| 34 | 2227108579 | 2225789004 | Bacteria | 38272 |
| 35 | IMNBL1DRAFT_c0031235 | 3300000062 | Bacteria | 1940 |
| 36 | Ga0068305_10176337 | 3300005083 | Unclassified | 2315 |
| 37 | Ga0123357_10000516 | 3300009784 | Bacteria | 37764 |
| 38 | Ga0466690_120487 | 3300042590 | Bacteria | 49787 |
| 39 | Ga0466692_108647 | 3300042591 | Bacteria | 182579 |
| 40 | Ga0466691_075210 | 3300042593 | Bacteria | 24277 |
| 41 | Ga0466705_191266 | 3300042612 | Bacteria | 24237 |
| 42 | Ga0466705_192566 | 3300042612 | Unclassified | 4694 |
| 43 | Ga0466733_035306 | 3300042659 | Bacteria | 102874 |
| 44 | Ga0466733_096051 | 3300042659 | Bacteria | 6105 |
| 45 | Ga0466733_116118 | 3300042659 | Bacteria | 3384 |
| 46 | Ga0466733_216382 | 3300042659 | Bacteria | 4955 |
| 47 | Ga0466710_274590 | 3300042613 | Bacteria | 2443 |
| 48 | Ga0466711_150328 | 3300042615 | Bacteria | 1633 |
| 49 | Ga0466715_028804 | 3300042616 | Bacteria | 13299 |
| 50 | Ga0466715_335119 | 3300042616 | Bacteria | 21011 |
| 51 | Ga0466728_356165 | 3300042620 | Bacteria | 2018 |
| 52 | Ga0466703_079899 | 3300042636 | Bacteria | 31311 |
| 53 | Ga0466704_087411 | 3300042643 | Bacteria | 64481 |
| 54 | Ga0466704_212215 | 3300042643 | Bacteria | 11445 |
| 55 | Ga0466709_197664 | 3300042648 | Bacteria | 8558 |
| 56 | Ga0123357_10012924 | 3300009784 | Bacteria | 10788 |
| 57 | Ga0466701_046580 | 3300042598 | Bacteria | 11258 |
| 58 | Ga0466701_072422 | 3300042598 | Bacteria | 50719 |
| 59 | Ga0466700_278370 | 3300042600 | Bacteria | 2777 |
| 60 | Ga0466713_140285 | 3300042602 | Bacteria | 3856 |
| 61 | Ga0466696_043628 | 3300042596 | Bacteria | 22568 |
| 62 | Ga0466696_203853 | 3300042596 | Bacteria | 22355 |
| 63 | Ga0466705_101063 | 3300042612 | Bacteria | 1494 |
| 64 | Ga0466732_184289 | 3300042656 | Bacteria | 6686 |
| 65 | Ga0466705_434662 | 3300042612 | Bacteria | 10118 |
| 66 | Ga0466705_512059 | 3300042612 | Bacteria | 18524 |
| 67 | Ga0466711_221321 | 3300042615 | Bacteria | 28835 |
| 68 | Ga0466715_048838 | 3300042616 | Bacteria | 2824 |
| 69 | Ga0466715_173388 | 3300042616 | Bacteria | 28414 |
| 70 | Ga0466715_356331 | 3300042616 | Bacteria | 30448 |
| 71 | Ga0466718_088028 | 3300042617 | Bacteria | 2299 |
| 72 | Ga0466723_344968 | 3300042618 | Bacteria | 22473 |
| 73 | Ga0466726_127183 | 3300042619 | Bacteria | 12133 |
| 74 | Ga0466731_120386 | 3300042622 | Bacteria | 1601 |
| 75 | Ga0466735_149323 | 3300042624 | Bacteria | 3601 |
| 76 | Ga0466704_055452 | 3300042643 | Bacteria | 12378 |
| 77 | Ga0466709_056442 | 3300042648 | Bacteria | 70841 |
| 78 | Ga0466709_198999 | 3300042648 | Bacteria | 5472 |
| 79 | Ga0466708_067864 | 3300042652 | Bacteria | 8863 |
| 80 | Ga0466708_293328 | 3300042652 | Bacteria | 56768 |
| 81 | Ga0466708_431015 | 3300042652 | Bacteria | 60350 |
| 82 | Ga0123356_10019780 | 3300010049 | Bacteria | 6380 |
| 83 | Ga0466706_058347 | 3300042599 | Bacteria | 1714 |
| 84 | Ga0466700_024426 | 3300042600 | Bacteria | 12749 |
| 85 | Ga0466707_137968 | 3300042601 | Bacteria | 35577 |
| 86 | Ga0466707_229461 | 3300042601 | Bacteria | 26081 |
| 87 | Ga0466713_016019 | 3300042602 | Bacteria | 439221 |
| 88 | Ga0466713_058210 | 3300042602 | Bacteria | 6120 |
| 89 | Ga0466713_140837 | 3300042602 | Bacteria | 175760 |
| 90 | Ga0466714_082642 | 3300042603 | Bacteria | 2291 |
| 91 | Ga0466719_020002 | 3300042606 | Bacteria | 5383 |
| 92 | Ga0466719_204841 | 3300042606 | Bacteria | 10896 |
| 93 | Ga0466719_306631 | 3300042606 | Bacteria | 5814 |
| 94 | Ga0466722_099833 | 3300042609 | Bacteria | 13763 |
| 95 | 2227563524 | 2225789004 | Bacteria | 14368 |
| 96 | IMNBL1DRAFT_c0001729 | 3300000062 | Bacteria | 16026 |
| 97 | JGI24702J35022_10000908 | 3300002462 | Bacteria | 18441 |
| 98 | JGI24705J35276_12237303 | 3300002504 | Bacteria | 10594 |
| 99 | Ga0160470_100327 | 3300012813 | Bacteria | 26398 |
| 100 | Ga0160445_105033 | 3300012847 | Bacteria | 2311 |
| 101 | Ga0466690_165942 | 3300042590 | Bacteria | 42807 |
| 102 | Ga0466691_050587 | 3300042593 | Bacteria | 28945 |
| 103 | Ga0466695_074549 | 3300042595 | Bacteria | 5561 |
| 104 | Ga0466696_071835 | 3300042596 | Bacteria | 17462 |
| 105 | Ga0466696_253412 | 3300042596 | Bacteria | 3365 |
| 106 | Ga0466705_035523 | 3300042612 | Bacteria | 13974 |
| 107 | Ga0466733_062764 | 3300042659 | Bacteria | 6557 |
| 108 | Ga0466733_201766 | 3300042659 | Bacteria | 18252 |
| 109 | Ga0466710_065877 | 3300042613 | Bacteria | 2595 |
| 110 | Ga0466710_103522 | 3300042613 | Bacteria | 5626 |
| 111 | Ga0466715_070998 | 3300042616 | Bacteria | 15747 |
| 112 | Ga0466715_157229 | 3300042616 | Bacteria | 4500 |
| 113 | Ga0466715_340014 | 3300042616 | Bacteria | 11262 |
| 114 | Ga0466715_496574 | 3300042616 | Bacteria | 33816 |
| 115 | Ga0466726_189537 | 3300042619 | Bacteria | 13531 |
| 116 | Ga0466728_154588 | 3300042620 | Bacteria | 35846 |
| 117 | Ga0466729_203041 | 3300042621 | Bacteria | 16265 |
| 118 | Ga0466734_024799 | 3300042623 | Bacteria | 3572 |
| 119 | Ga0466735_078777 | 3300042624 | Bacteria | 3099 |
| 120 | Ga0466703_021603 | 3300042636 | Bacteria | 26593 |
| 121 | Ga0466703_213836 | 3300042636 | Bacteria | 25750 |
| 122 | Ga0466704_174538 | 3300042643 | Bacteria | 20210 |
| 123 | Ga0466724_07109 | 3300042649 | Bacteria | 285871 |
| 124 | Ga0466708_227517 | 3300042652 | Bacteria | 22950 |
| 125 | Ga0466727_019690 | 3300042655 | Bacteria | 3016 |
| 126 | Ga0466727_200454 | 3300042655 | Bacteria | 12081 |
| 127 | Ga0466727_273168 | 3300042655 | Bacteria | 14099 |
| 128 | Ga0123357_10014648 | 3300009784 | Bacteria | 10244 |
| 129 | Ga0123357_10047166 | 3300009784 | Bacteria | 5840 |
| 130 | Ga0123356_10057291 | 3300010049 | Bacteria | 3631 |
| 131 | Ga0466706_010686 | 3300042599 | Bacteria | 53689 |
| 132 | Ga0466706_088248 | 3300042599 | Bacteria | 22894 |
| 133 | Ga0466706_225845 | 3300042599 | Bacteria | 5423 |
| 134 | Ga0466713_104463 | 3300042602 | Bacteria | 13074 |
| 135 | Ga0466713_156423 | 3300042602 | Bacteria | 30043 |
| 136 | Ga0466714_014480 | 3300042603 | Bacteria | 6491 |
| 137 | Ga0466716_039112 | 3300042605 | Bacteria | 6957 |
| 138 | Ga0466697_047479 | 3300042611 | Bacteria | 73888 |
| 139 | 2226985949 | 2225789003 | Bacteria | 7847 |
| 140 | 2227425264 | 2225789004 | Bacteria | 5592 |
| 141 | JGI24702J35022_10020194 | 3300002462 | Bacteria | 3618 |
| 142 | Ga0068302_10082294 | 3300005071 | Bacteria | 2044 |
| 143 | Ga0466691_071799 | 3300042593 | Bacteria | 28796 |
| 144 | Ga0466691_139956 | 3300042593 | Bacteria | 18484 |
| 145 | Ga0466696_093504 | 3300042596 | Bacteria | 2329 |
| 146 | Ga0466733_222052 | 3300042659 | Bacteria | 81292 |
| 147 | Ga0466711_241205 | 3300042615 | Bacteria | 25347 |
| 148 | Ga0466715_638737 | 3300042616 | Bacteria | 12415 |
| 149 | Ga0466723_213339 | 3300042618 | Bacteria | 25634 |
| 150 | Ga0466723_321879 | 3300042618 | Bacteria | 18189 |
| 151 | Ga0466726_403200 | 3300042619 | Bacteria | 6852 |
| 152 | Ga0466735_112480 | 3300042624 | Bacteria | 3042 |
| 153 | Ga0466703_235317 | 3300042636 | Bacteria | 13280 |
| 154 | Ga0466703_285014 | 3300042636 | Bacteria | 20640 |
| 155 | Ga0466704_475673 | 3300042643 | Bacteria | 25542 |
| 156 | Ga0466704_510642 | 3300042643 | Bacteria | 18412 |
| 157 | Ga0466709_298775 | 3300042648 | Bacteria | 18829 |
| 158 | Ga0123356_10000307 | 3300010049 | Bacteria | 55981 |
| 159 | Ga0123353_10000499 | 3300010167 | Bacteria | 48625 |
| 160 | Ga0123354_10001503 | 3300010882 | Bacteria | 28513 |
| 161 | Ga0466706_193089 | 3300042599 | Bacteria | 58339 |
| 162 | Ga0466706_219490 | 3300042599 | Bacteria | 10120 |
| 163 | Ga0466700_030653 | 3300042600 | Bacteria | 3668 |
| 164 | Ga0466707_179990 | 3300042601 | Bacteria | 21609 |
| 165 | Ga0466707_350012 | 3300042601 | Bacteria | 5435 |
| 166 | Ga0466713_044978 | 3300042602 | Bacteria | 4520 |
| 167 | Ga0466714_062703 | 3300042603 | Bacteria | 39199 |
| 168 | Ga0466714_085675 | 3300042603 | Bacteria | 2079 |
| 169 | Ga0466716_285106 | 3300042605 | Bacteria | 16688 |
| 170 | Ga0466716_466502 | 3300042605 | Bacteria | 8161 |
| 171 | 2227544076 | 2225789004 | Bacteria | 15432 |
| 172 | IMNBL1DRAFT_c0006239 | 3300000062 | Bacteria | 6552 |
| 173 | IMNBL1DRAFT_c0007965 | 3300000062 | Bacteria | 5469 |
| 174 | JGI24702J35022_10001006 | 3300002462 | Bacteria | 17651 |
| 175 | JGI24705J35276_12227262 | 3300002504 | Bacteria | 2973 |
| 176 | Ga0160452_103702 | 3300012834 | Bacteria | 2583 |
| 177 | Ga0466657_161362 | 3300042582 | Bacteria | 2257 |
| 178 | Ga0466690_037129 | 3300042590 | Bacteria | 12289 |
| 179 | Ga0466690_079356 | 3300042590 | Bacteria | 27297 |
| 180 | Ga0466691_212492 | 3300042593 | Bacteria | 29583 |
| 181 | Ga0466733_019981 | 3300042659 | Bacteria | 4153 |
| 182 | Ga0466733_050745 | 3300042659 | Bacteria | 18476 |
| 183 | Ga0466715_342363 | 3300042616 | Bacteria | 29081 |
| 184 | Ga0466723_328155 | 3300042618 | Bacteria | 13697 |
| 185 | Ga0466726_235876 | 3300042619 | Bacteria | 22446 |
| 186 | Ga0466728_343837 | 3300042620 | Bacteria | 32467 |
| 187 | Ga0466704_320437 | 3300042643 | Bacteria | 10713 |
| 188 | Ga0466704_416614 | 3300042643 | Bacteria | 9078 |
| 189 | Ga0466724_32012 | 3300042649 | Bacteria | 3044 |
| 190 | Ga0466708_279340 | 3300042652 | Bacteria | 55893 |
| 191 | Ga0466727_003374 | 3300042655 | Bacteria | 4462 |
| 192 | Ga0123353_10004271 | 3300010167 | Bacteria | 18357 |
| 193 | Ga0123354_10000907 | 3300010882 | Bacteria | 33208 |
| 194 | Ga0123354_10061348 | 3300010882 | Bacteria | 5550 |
| 195 | Ga0466706_051828 | 3300042599 | Bacteria | 24965 |
| 196 | Ga0466706_218375 | 3300042599 | Bacteria | 57228 |
| 197 | Ga0466706_273108 | 3300042599 | Bacteria | 17983 |
| 198 | Ga0466707_112808 | 3300042601 | Bacteria | 3810 |
| 199 | Ga0466713_089588 | 3300042602 | Bacteria | 4773 |
| 200 | Ga0466714_051125 | 3300042603 | Bacteria | 52861 |
| 201 | Ga0466716_292444 | 3300042605 | Bacteria | 7913 |
| 202 | Ga0466719_139096 | 3300042606 | Bacteria | 15810 |
| 203 | Ga0466722_062829 | 3300042609 | Bacteria | 60409 |
| 204 | 2227072478 | 2225789003 | Bacteria | 2536 |
| 205 | IMNBL1DRAFT_c0001589 | 3300000062 | Bacteria | 16869 |
| 206 | IMNBL1DRAFT_c0015896 | 3300000062 | Bacteria | 3243 |
| 207 | JGI24702J35022_10006025 | 3300002462 | Bacteria | 7041 |
| 208 | Meta3P_1003977 | 3300002464 | Bacteria | 5232 |
| 209 | Ga0068302_10017471 | 3300005071 | Bacteria | 10014 |
| 210 | Ga0068302_10208904 | 3300005071 | Bacteria | 2664 |
| 211 | Ga0157631_128178 | 3300013007 | Bacteria | 3545 |
| 212 | Ga0466697_124478 | 3300042611 | Bacteria | 1747 |
| 213 | Ga0466705_313620 | 3300042612 | Bacteria | 2003 |
| 214 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 215 | Ga0466710_010418 | 3300042613 | Bacteria | 9703 |
| 216 | Ga0466711_196075 | 3300042615 | Bacteria | 21098 |
| 217 | Ga0466715_158405 | 3300042616 | Bacteria | 12432 |
| 218 | Ga0466723_271308 | 3300042618 | Bacteria | 19297 |
| 219 | Ga0466728_021517 | 3300042620 | Bacteria | 26535 |
| 220 | Ga0466728_024833 | 3300042620 | Bacteria | 2577 |
| 221 | Ga0466728_139772 | 3300042620 | Bacteria | 16405 |
| 222 | Ga0466703_196216 | 3300042636 | Bacteria | 4806 |
| 223 | Ga0466704_021424 | 3300042643 | Bacteria | 5128 |
| 224 | Ga0466704_041870 | 3300042643 | Bacteria | 10680 |
| 225 | Ga0466709_335459 | 3300042648 | Bacteria | 2535 |
| 226 | Ga0466727_198240 | 3300042655 | Bacteria | 25398 |
| 227 | Ga0466727_248760 | 3300042655 | Bacteria | 44850 |
| 228 | Ga0123357_10006572 | 3300009784 | Bacteria | 14224 |
| 229 | Ga0123354_10143684 | 3300010882 | Bacteria | 2935 |
| 230 | Ga0466701_050423 | 3300042598 | Bacteria | 264361 |
| 231 | Ga0466713_011123 | 3300042602 | Bacteria | 28410 |
| 232 | Ga0466713_130991 | 3300042602 | Bacteria | 214088 |
| 233 | Ga0466716_193411 | 3300042605 | Bacteria | 10892 |
| 234 | Ga0466719_042604 | 3300042606 | Bacteria | 12458 |
| 235 | Ga0466719_072345 | 3300042606 | Bacteria | 10626 |
| 236 | JGI24699J35502_11134040 | 3300002509 | Bacteria | 26231 |
| 237 | JGI24699J35502_11134156 | 3300002509 | Bacteria | 38534 |
| 238 | JGI24699J35502_11134228 | 3300002509 | Bacteria | 91082 |
| 239 | Ga0104048_1022358 | 3300007143 | Bacteria | 4466 |
| 240 | Ga0104050_1000301 | 3300007153 | Bacteria | 2970 |
| 241 | Ga0123357_10000188 | 3300009784 | Bacteria | 57626 |
| 242 | Ga0123357_10000751 | 3300009784 | Bacteria | 32682 |
| 243 | Ga0466690_062374 | 3300042590 | Bacteria | 6625 |
| 244 | Ga0466690_069865 | 3300042590 | Bacteria | 123255 |
| 245 | Ga0466690_179317 | 3300042590 | Bacteria | 43431 |
| 246 | Ga0466691_163266 | 3300042593 | Bacteria | 27713 |
| 247 | Ga0466696_299474 | 3300042596 | Bacteria | 22051 |
| 248 | Ga0466696_388650 | 3300042596 | Bacteria | 3101 |
| 249 | Ga0466705_119745 | 3300042612 | Bacteria | 31799 |
| 250 | Ga0466733_008626 | 3300042659 | Bacteria | 66692 |
| 251 | Ga0466733_074272 | 3300042659 | Bacteria | 5324 |
| 252 | Ga0466733_212390 | 3300042659 | Bacteria | 6511 |
| 253 | Ga0466711_189516 | 3300042615 | Bacteria | 18147 |
| 254 | Ga0466715_064161 | 3300042616 | Bacteria | 33093 |
| 255 | Ga0466715_078929 | 3300042616 | Bacteria | 42957 |
| 256 | Ga0466715_210726 | 3300042616 | Bacteria | 3014 |
| 257 | Ga0466726_079499 | 3300042619 | Bacteria | 13489 |
| 258 | Ga0466728_279823 | 3300042620 | Bacteria | 34589 |
| 259 | Ga0466729_178531 | 3300042621 | Bacteria | 4164 |
| 260 | Ga0466735_033802 | 3300042624 | Bacteria | 2791 |
| 261 | Ga0466735_186676 | 3300042624 | Bacteria | 2329 |
| 262 | Ga0466703_140926 | 3300042636 | Bacteria | 16524 |
| 263 | Ga0466704_602482 | 3300042643 | Bacteria | 52119 |
| 264 | Ga0466727_346371 | 3300042655 | Bacteria | 9584 |
| 265 | Ga0466701_067444 | 3300042598 | Bacteria | 75683 |
| 266 | Ga0466701_087772 | 3300042598 | Bacteria | 51593 |
| 267 | Ga0466706_158580 | 3300042599 | Bacteria | 37190 |
| 268 | Ga0466700_260585 | 3300042600 | Bacteria | 4216 |
| 269 | Ga0466716_039975 | 3300042605 | Bacteria | 23276 |
| 270 | Ga0466716_149833 | 3300042605 | Bacteria | 35494 |
| 271 | 2227266896 | 2225789004 | Bacteria | 6961 |
| 272 | IMNBL1DRAFT_c0001117 | 3300000062 | Bacteria | 20544 |
| 273 | JGI24699J35502_11134159 | 3300002509 | Bacteria | 40635 |
| 274 | Ga0068302_10094765 | 3300005071 | Bacteria | 4459 |
| 275 | Ga0068302_10148394 | 3300005071 | Bacteria | 8259 |
| 276 | Ga0068302_10154907 | 3300005071 | Bacteria | 3867 |
| 277 | Ga0068305_10066497 | 3300005083 | Bacteria | 10618 |
| 278 | Ga0072941_1048401 | 3300005201 | Bacteria | 16187 |
| 279 | Ga0104050_1002808 | 3300007153 | Bacteria | 4071 |
| 280 | Ga0123357_10000244 | 3300009784 | Bacteria | 51714 |
| 281 | Ga0466690_133199 | 3300042590 | Bacteria | 27284 |
| 282 | Ga0466696_019536 | 3300042596 | Bacteria | 48880 |
| 283 | Ga0466696_235585 | 3300042596 | Bacteria | 8917 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.