Protein Family IF07704

Metagenome Isolate
346 Members
122 Samples
283 Scaffolds
448.53 Avg Length

🧬 Representative Sequence

ID
3300042616|Ga0466715_210726|Ga0466715_210726_981_2477
Length
498 aa
Sequence
LVDWDYSGGFGDCDFENEVIDYEQNMIMINIKKKENKGINLAEFMPSVLRRLVVLGAGESGAGAAVLAKKKGFDVFVSDLSTIKDKYKEILERYEIPYEEGFHTEEKILNANEVIKSPGIPDKAPIVKKLTAQNTPVISEIEFAGRYTNAKTICITGSNGKTTTTMLTYHILKSAGLNVGLAGNVGESFALQVAEQDYDYYVIELSSFQLDGMYDFRADIAVLLNITPDHLDRYNYEMQNYVDAKMRIIQNQTAADAFIFWNGDPTVKLRITNYGLRNDKKLCPALYPFAQFKEEGVIAYTENKQIIINTPKGNFNMEEELVALTGTHNLYNSLAAGIAAKLLDIKNEDIRRSLSDFKGVEHRLEKVAKVRGVEYINDSKATNVNSTWYALQSMKTPVVLILGGTDKGNDYREIEALVKEKCRALIYLGVDNSKLHKFFDGKVSQTTEAHSMEEAVSKAYDIAETGDTVLLSPCCASFDLFENYEDRGKQFKHYVRKL

πŸ“Š Sample Types

Isolate 18.2%
Metagenome 81.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Blattidae 25.2%
Termitidae 18.5%
Kalotermitidae 11.8%
Unclassified 10.9%
Elmidae 7.6%
Culicidae 5.0%
Rhinotermitidae 4.2%
Termopsidae 3.4%
Passalidae 2.5%
Daphniidae 1.7%
Hydrophilidae 1.7%
Tenebrionidae 1.7%
Drosophilidae 1.7%
Cambaridae 1.7%
Hodotermitidae 0.8%
Kiwaidae 0.8%
Armadillidiidae 0.8%

🌳 Taxonomy

Archaea 0
Bacteria 343
Eukaryota 0
Viruses 0
Unclassified 3

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2811995047 Flavobacterium succinicans DD5b Isolate Daphniidae
2 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
3 2864831662 Chryseobacterium sediminis S00068 Isolate Elmidae
4 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
5 2904728850 Flavobacterium sp. xlx-214 Isolate
6 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
7 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
8 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
9 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
10 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
11 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
12 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
13 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
14 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
15 8020009074 Elizabethkingia anophelis MSU001 Isolate Culicidae
16 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
17 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
18 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
19 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
20 2864923010 Elizabethkingia anophelis S00177 Isolate Elmidae
21 2899132286 Myroides albus BIT-d1 Isolate Tenebrionidae
22 2922326829 Bacteroides sp. 224 Isolate Blattidae
23 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
24 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
25 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
26 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
27 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
28 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
29 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
30 8114076984 Elizabethkingia anophelis R26 Isolate Culicidae
31 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
32 2864788197 Elizabethkingia anophelis S00027 Isolate Elmidae
33 2864822740 Chryseobacterium shigense S00064 Isolate Elmidae
34 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
35 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
36 2923982719 Parabacteroides sp. 52 Isolate Blattidae
37 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
38 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
39 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
40 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
41 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
42 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
43 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
44 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
45 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
46 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
47 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
48 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
49 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
50 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
51 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
52 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
53 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
54 2529292732 Elizabethkingia anophelis R26 Isolate Culicidae
55 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
56 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
57 2864878056 Flavobacterium notoginsengisoli S00128 Isolate Elmidae
58 2864886855 Flavobacterium nitrogenifigens S00142 Isolate Elmidae
59 2920168565 Paludibacter sp. 221 Isolate Blattidae
60 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
61 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
62 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
63 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
64 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
65 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
66 2590828803 Pedobacter glucosidilyticus DD6b Isolate Daphniidae
67 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
68 2820776227 Unclassified Bacteroidetes Emb289P4bin3 Isolate Unclassified
69 2864948220 Elizabethkingia anophelis S00205 Isolate Elmidae
70 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
71 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
72 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
73 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
74 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
75 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
76 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
77 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
78 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
79 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
80 2921902974 Chryseobacterium sp. cx-624 Isolate Cambaridae
81 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
82 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
83 2958471994 Flavobacterium sp. xlx-221 Isolate Cambaridae
84 3300013007 Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts Metagenome Kiwaidae
85 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
86 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
87 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
88 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
89 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
90 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
91 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
92 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
93 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
94 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
95 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
96 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
97 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
98 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
99 2687453786 Chryseobacterium culicis DSM 23031 Isolate Unclassified
100 2820781750 Unclassified Bacteroidetes Emb289P3bin89 Isolate Unclassified
101 2847090942 Elizabethkingia anophelis Ag1 Isolate Culicidae
102 2864882932 Chryseobacterium shingense S00136 Isolate Elmidae
103 2864891731 Chryseobacterium defluvii S00151 Isolate Elmidae
104 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
105 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
106 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
107 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
108 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
109 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
110 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
111 3004672520 Bacteroides sp. 51 Isolate Blattidae
112 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
113 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
114 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
115 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
116 643348524 Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 Isolate Unclassified
117 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
118 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
119 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
120 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
121 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
122 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_004521 3300042612 Bacteria 9564
2 Ga0466705_024977 3300042612 Bacteria 9985
3 Ga0466733_022772 3300042659 Bacteria 146320
4 Ga0466733_181724 3300042659 Bacteria 66237
5 Ga0466711_063536 3300042615 Bacteria 6062
6 Ga0466711_219426 3300042615 Bacteria 1739
7 Ga0466715_089480 3300042616 Bacteria 17534
8 Ga0466726_364377 3300042619 Bacteria 2297
9 Ga0466726_383047 3300042619 Bacteria 3103
10 Ga0466728_393205 3300042620 Bacteria 4205
11 Ga0466730_071786 3300042625 Bacteria 741189
12 Ga0466703_102327 3300042636 Bacteria 38440
13 Ga0466703_262959 3300042636 Bacteria 29096
14 Ga0466704_139994 3300042643 Bacteria 7248
15 Ga0466709_137811 3300042648 Bacteria 185438
16 Ga0466708_095594 3300042652 Bacteria 24720
17 Ga0466708_196684 3300042652 Bacteria 22308
18 Ga0466725_202265 3300042654 Bacteria 20853
19 Ga0466727_321137 3300042655 Bacteria 3868
20 Ga0123356_10162645 3300010049 Bacteria 2232
21 Ga0123353_10556308 3300010167 Bacteria 1653
22 Ga0123354_10010069 3300010882 Bacteria 14523
23 Ga0123354_10030009 3300010882 Bacteria 8545
24 Ga0466706_137590 3300042599 Bacteria 25056
25 Ga0466707_347366 3300042601 Bacteria 6060
26 Ga0466713_021377 3300042602 Bacteria 32539
27 Ga0466713_089753 3300042602 Bacteria 35618
28 Ga0466714_039286 3300042603 Bacteria 40419
29 Ga0466719_124438 3300042606 Bacteria 5095
30 Ga0466719_176700 3300042606 Bacteria 1945
31 Ga0466722_062608 3300042609 Bacteria 10750
32 Ga0466722_143739 3300042609 Bacteria 19742
33 2227066935 2225789003 Unclassified 3148
34 2227108579 2225789004 Bacteria 38272
35 IMNBL1DRAFT_c0031235 3300000062 Bacteria 1940
36 Ga0068305_10176337 3300005083 Unclassified 2315
37 Ga0123357_10000516 3300009784 Bacteria 37764
38 Ga0466690_120487 3300042590 Bacteria 49787
39 Ga0466692_108647 3300042591 Bacteria 182579
40 Ga0466691_075210 3300042593 Bacteria 24277
41 Ga0466705_191266 3300042612 Bacteria 24237
42 Ga0466705_192566 3300042612 Unclassified 4694
43 Ga0466733_035306 3300042659 Bacteria 102874
44 Ga0466733_096051 3300042659 Bacteria 6105
45 Ga0466733_116118 3300042659 Bacteria 3384
46 Ga0466733_216382 3300042659 Bacteria 4955
47 Ga0466710_274590 3300042613 Bacteria 2443
48 Ga0466711_150328 3300042615 Bacteria 1633
49 Ga0466715_028804 3300042616 Bacteria 13299
50 Ga0466715_335119 3300042616 Bacteria 21011
51 Ga0466728_356165 3300042620 Bacteria 2018
52 Ga0466703_079899 3300042636 Bacteria 31311
53 Ga0466704_087411 3300042643 Bacteria 64481
54 Ga0466704_212215 3300042643 Bacteria 11445
55 Ga0466709_197664 3300042648 Bacteria 8558
56 Ga0123357_10012924 3300009784 Bacteria 10788
57 Ga0466701_046580 3300042598 Bacteria 11258
58 Ga0466701_072422 3300042598 Bacteria 50719
59 Ga0466700_278370 3300042600 Bacteria 2777
60 Ga0466713_140285 3300042602 Bacteria 3856
61 Ga0466696_043628 3300042596 Bacteria 22568
62 Ga0466696_203853 3300042596 Bacteria 22355
63 Ga0466705_101063 3300042612 Bacteria 1494
64 Ga0466732_184289 3300042656 Bacteria 6686
65 Ga0466705_434662 3300042612 Bacteria 10118
66 Ga0466705_512059 3300042612 Bacteria 18524
67 Ga0466711_221321 3300042615 Bacteria 28835
68 Ga0466715_048838 3300042616 Bacteria 2824
69 Ga0466715_173388 3300042616 Bacteria 28414
70 Ga0466715_356331 3300042616 Bacteria 30448
71 Ga0466718_088028 3300042617 Bacteria 2299
72 Ga0466723_344968 3300042618 Bacteria 22473
73 Ga0466726_127183 3300042619 Bacteria 12133
74 Ga0466731_120386 3300042622 Bacteria 1601
75 Ga0466735_149323 3300042624 Bacteria 3601
76 Ga0466704_055452 3300042643 Bacteria 12378
77 Ga0466709_056442 3300042648 Bacteria 70841
78 Ga0466709_198999 3300042648 Bacteria 5472
79 Ga0466708_067864 3300042652 Bacteria 8863
80 Ga0466708_293328 3300042652 Bacteria 56768
81 Ga0466708_431015 3300042652 Bacteria 60350
82 Ga0123356_10019780 3300010049 Bacteria 6380
83 Ga0466706_058347 3300042599 Bacteria 1714
84 Ga0466700_024426 3300042600 Bacteria 12749
85 Ga0466707_137968 3300042601 Bacteria 35577
86 Ga0466707_229461 3300042601 Bacteria 26081
87 Ga0466713_016019 3300042602 Bacteria 439221
88 Ga0466713_058210 3300042602 Bacteria 6120
89 Ga0466713_140837 3300042602 Bacteria 175760
90 Ga0466714_082642 3300042603 Bacteria 2291
91 Ga0466719_020002 3300042606 Bacteria 5383
92 Ga0466719_204841 3300042606 Bacteria 10896
93 Ga0466719_306631 3300042606 Bacteria 5814
94 Ga0466722_099833 3300042609 Bacteria 13763
95 2227563524 2225789004 Bacteria 14368
96 IMNBL1DRAFT_c0001729 3300000062 Bacteria 16026
97 JGI24702J35022_10000908 3300002462 Bacteria 18441
98 JGI24705J35276_12237303 3300002504 Bacteria 10594
99 Ga0160470_100327 3300012813 Bacteria 26398
100 Ga0160445_105033 3300012847 Bacteria 2311
101 Ga0466690_165942 3300042590 Bacteria 42807
102 Ga0466691_050587 3300042593 Bacteria 28945
103 Ga0466695_074549 3300042595 Bacteria 5561
104 Ga0466696_071835 3300042596 Bacteria 17462
105 Ga0466696_253412 3300042596 Bacteria 3365
106 Ga0466705_035523 3300042612 Bacteria 13974
107 Ga0466733_062764 3300042659 Bacteria 6557
108 Ga0466733_201766 3300042659 Bacteria 18252
109 Ga0466710_065877 3300042613 Bacteria 2595
110 Ga0466710_103522 3300042613 Bacteria 5626
111 Ga0466715_070998 3300042616 Bacteria 15747
112 Ga0466715_157229 3300042616 Bacteria 4500
113 Ga0466715_340014 3300042616 Bacteria 11262
114 Ga0466715_496574 3300042616 Bacteria 33816
115 Ga0466726_189537 3300042619 Bacteria 13531
116 Ga0466728_154588 3300042620 Bacteria 35846
117 Ga0466729_203041 3300042621 Bacteria 16265
118 Ga0466734_024799 3300042623 Bacteria 3572
119 Ga0466735_078777 3300042624 Bacteria 3099
120 Ga0466703_021603 3300042636 Bacteria 26593
121 Ga0466703_213836 3300042636 Bacteria 25750
122 Ga0466704_174538 3300042643 Bacteria 20210
123 Ga0466724_07109 3300042649 Bacteria 285871
124 Ga0466708_227517 3300042652 Bacteria 22950
125 Ga0466727_019690 3300042655 Bacteria 3016
126 Ga0466727_200454 3300042655 Bacteria 12081
127 Ga0466727_273168 3300042655 Bacteria 14099
128 Ga0123357_10014648 3300009784 Bacteria 10244
129 Ga0123357_10047166 3300009784 Bacteria 5840
130 Ga0123356_10057291 3300010049 Bacteria 3631
131 Ga0466706_010686 3300042599 Bacteria 53689
132 Ga0466706_088248 3300042599 Bacteria 22894
133 Ga0466706_225845 3300042599 Bacteria 5423
134 Ga0466713_104463 3300042602 Bacteria 13074
135 Ga0466713_156423 3300042602 Bacteria 30043
136 Ga0466714_014480 3300042603 Bacteria 6491
137 Ga0466716_039112 3300042605 Bacteria 6957
138 Ga0466697_047479 3300042611 Bacteria 73888
139 2226985949 2225789003 Bacteria 7847
140 2227425264 2225789004 Bacteria 5592
141 JGI24702J35022_10020194 3300002462 Bacteria 3618
142 Ga0068302_10082294 3300005071 Bacteria 2044
143 Ga0466691_071799 3300042593 Bacteria 28796
144 Ga0466691_139956 3300042593 Bacteria 18484
145 Ga0466696_093504 3300042596 Bacteria 2329
146 Ga0466733_222052 3300042659 Bacteria 81292
147 Ga0466711_241205 3300042615 Bacteria 25347
148 Ga0466715_638737 3300042616 Bacteria 12415
149 Ga0466723_213339 3300042618 Bacteria 25634
150 Ga0466723_321879 3300042618 Bacteria 18189
151 Ga0466726_403200 3300042619 Bacteria 6852
152 Ga0466735_112480 3300042624 Bacteria 3042
153 Ga0466703_235317 3300042636 Bacteria 13280
154 Ga0466703_285014 3300042636 Bacteria 20640
155 Ga0466704_475673 3300042643 Bacteria 25542
156 Ga0466704_510642 3300042643 Bacteria 18412
157 Ga0466709_298775 3300042648 Bacteria 18829
158 Ga0123356_10000307 3300010049 Bacteria 55981
159 Ga0123353_10000499 3300010167 Bacteria 48625
160 Ga0123354_10001503 3300010882 Bacteria 28513
161 Ga0466706_193089 3300042599 Bacteria 58339
162 Ga0466706_219490 3300042599 Bacteria 10120
163 Ga0466700_030653 3300042600 Bacteria 3668
164 Ga0466707_179990 3300042601 Bacteria 21609
165 Ga0466707_350012 3300042601 Bacteria 5435
166 Ga0466713_044978 3300042602 Bacteria 4520
167 Ga0466714_062703 3300042603 Bacteria 39199
168 Ga0466714_085675 3300042603 Bacteria 2079
169 Ga0466716_285106 3300042605 Bacteria 16688
170 Ga0466716_466502 3300042605 Bacteria 8161
171 2227544076 2225789004 Bacteria 15432
172 IMNBL1DRAFT_c0006239 3300000062 Bacteria 6552
173 IMNBL1DRAFT_c0007965 3300000062 Bacteria 5469
174 JGI24702J35022_10001006 3300002462 Bacteria 17651
175 JGI24705J35276_12227262 3300002504 Bacteria 2973
176 Ga0160452_103702 3300012834 Bacteria 2583
177 Ga0466657_161362 3300042582 Bacteria 2257
178 Ga0466690_037129 3300042590 Bacteria 12289
179 Ga0466690_079356 3300042590 Bacteria 27297
180 Ga0466691_212492 3300042593 Bacteria 29583
181 Ga0466733_019981 3300042659 Bacteria 4153
182 Ga0466733_050745 3300042659 Bacteria 18476
183 Ga0466715_342363 3300042616 Bacteria 29081
184 Ga0466723_328155 3300042618 Bacteria 13697
185 Ga0466726_235876 3300042619 Bacteria 22446
186 Ga0466728_343837 3300042620 Bacteria 32467
187 Ga0466704_320437 3300042643 Bacteria 10713
188 Ga0466704_416614 3300042643 Bacteria 9078
189 Ga0466724_32012 3300042649 Bacteria 3044
190 Ga0466708_279340 3300042652 Bacteria 55893
191 Ga0466727_003374 3300042655 Bacteria 4462
192 Ga0123353_10004271 3300010167 Bacteria 18357
193 Ga0123354_10000907 3300010882 Bacteria 33208
194 Ga0123354_10061348 3300010882 Bacteria 5550
195 Ga0466706_051828 3300042599 Bacteria 24965
196 Ga0466706_218375 3300042599 Bacteria 57228
197 Ga0466706_273108 3300042599 Bacteria 17983
198 Ga0466707_112808 3300042601 Bacteria 3810
199 Ga0466713_089588 3300042602 Bacteria 4773
200 Ga0466714_051125 3300042603 Bacteria 52861
201 Ga0466716_292444 3300042605 Bacteria 7913
202 Ga0466719_139096 3300042606 Bacteria 15810
203 Ga0466722_062829 3300042609 Bacteria 60409
204 2227072478 2225789003 Bacteria 2536
205 IMNBL1DRAFT_c0001589 3300000062 Bacteria 16869
206 IMNBL1DRAFT_c0015896 3300000062 Bacteria 3243
207 JGI24702J35022_10006025 3300002462 Bacteria 7041
208 Meta3P_1003977 3300002464 Bacteria 5232
209 Ga0068302_10017471 3300005071 Bacteria 10014
210 Ga0068302_10208904 3300005071 Bacteria 2664
211 Ga0157631_128178 3300013007 Bacteria 3545
212 Ga0466697_124478 3300042611 Bacteria 1747
213 Ga0466705_313620 3300042612 Bacteria 2003
214 Ga0562377_0004 3300056842 Bacteria 3525959
215 Ga0466710_010418 3300042613 Bacteria 9703
216 Ga0466711_196075 3300042615 Bacteria 21098
217 Ga0466715_158405 3300042616 Bacteria 12432
218 Ga0466723_271308 3300042618 Bacteria 19297
219 Ga0466728_021517 3300042620 Bacteria 26535
220 Ga0466728_024833 3300042620 Bacteria 2577
221 Ga0466728_139772 3300042620 Bacteria 16405
222 Ga0466703_196216 3300042636 Bacteria 4806
223 Ga0466704_021424 3300042643 Bacteria 5128
224 Ga0466704_041870 3300042643 Bacteria 10680
225 Ga0466709_335459 3300042648 Bacteria 2535
226 Ga0466727_198240 3300042655 Bacteria 25398
227 Ga0466727_248760 3300042655 Bacteria 44850
228 Ga0123357_10006572 3300009784 Bacteria 14224
229 Ga0123354_10143684 3300010882 Bacteria 2935
230 Ga0466701_050423 3300042598 Bacteria 264361
231 Ga0466713_011123 3300042602 Bacteria 28410
232 Ga0466713_130991 3300042602 Bacteria 214088
233 Ga0466716_193411 3300042605 Bacteria 10892
234 Ga0466719_042604 3300042606 Bacteria 12458
235 Ga0466719_072345 3300042606 Bacteria 10626
236 JGI24699J35502_11134040 3300002509 Bacteria 26231
237 JGI24699J35502_11134156 3300002509 Bacteria 38534
238 JGI24699J35502_11134228 3300002509 Bacteria 91082
239 Ga0104048_1022358 3300007143 Bacteria 4466
240 Ga0104050_1000301 3300007153 Bacteria 2970
241 Ga0123357_10000188 3300009784 Bacteria 57626
242 Ga0123357_10000751 3300009784 Bacteria 32682
243 Ga0466690_062374 3300042590 Bacteria 6625
244 Ga0466690_069865 3300042590 Bacteria 123255
245 Ga0466690_179317 3300042590 Bacteria 43431
246 Ga0466691_163266 3300042593 Bacteria 27713
247 Ga0466696_299474 3300042596 Bacteria 22051
248 Ga0466696_388650 3300042596 Bacteria 3101
249 Ga0466705_119745 3300042612 Bacteria 31799
250 Ga0466733_008626 3300042659 Bacteria 66692
251 Ga0466733_074272 3300042659 Bacteria 5324
252 Ga0466733_212390 3300042659 Bacteria 6511
253 Ga0466711_189516 3300042615 Bacteria 18147
254 Ga0466715_064161 3300042616 Bacteria 33093
255 Ga0466715_078929 3300042616 Bacteria 42957
256 Ga0466715_210726 3300042616 Bacteria 3014
257 Ga0466726_079499 3300042619 Bacteria 13489
258 Ga0466728_279823 3300042620 Bacteria 34589
259 Ga0466729_178531 3300042621 Bacteria 4164
260 Ga0466735_033802 3300042624 Bacteria 2791
261 Ga0466735_186676 3300042624 Bacteria 2329
262 Ga0466703_140926 3300042636 Bacteria 16524
263 Ga0466704_602482 3300042643 Bacteria 52119
264 Ga0466727_346371 3300042655 Bacteria 9584
265 Ga0466701_067444 3300042598 Bacteria 75683
266 Ga0466701_087772 3300042598 Bacteria 51593
267 Ga0466706_158580 3300042599 Bacteria 37190
268 Ga0466700_260585 3300042600 Bacteria 4216
269 Ga0466716_039975 3300042605 Bacteria 23276
270 Ga0466716_149833 3300042605 Bacteria 35494
271 2227266896 2225789004 Bacteria 6961
272 IMNBL1DRAFT_c0001117 3300000062 Bacteria 20544
273 JGI24699J35502_11134159 3300002509 Bacteria 40635
274 Ga0068302_10094765 3300005071 Bacteria 4459
275 Ga0068302_10148394 3300005071 Bacteria 8259
276 Ga0068302_10154907 3300005071 Bacteria 3867
277 Ga0068305_10066497 3300005083 Bacteria 10618
278 Ga0072941_1048401 3300005201 Bacteria 16187
279 Ga0104050_1002808 3300007153 Bacteria 4071
280 Ga0123357_10000244 3300009784 Bacteria 51714
281 Ga0466690_133199 3300042590 Bacteria 27284
282 Ga0466696_019536 3300042596 Bacteria 48880
283 Ga0466696_235585 3300042596 Bacteria 8917

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF21799 MurD-like_N Mur ligase MurD-like, N-terminal domain 51 138 0.94
PF02875 Mur_ligase_C Mur ligase, glutamate ligase domain 362 474 0.93
PF21377 MurD_N MurD N-terminal domain 55 121 0.84
PF08245 Mur_ligase_M Mur ligase middle domain 155 339 0.78

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.