Protein Family IF07690
Metagenome
Metatranscriptome
Isolate
192
Members
76
Samples
145
Scaffolds
151.08
Avg Length
Representative Sequence
- ID
- 3300042616|Ga0466715_183088|Ga0466715_183088_21448_21966
- Length
- 172 aa
- Sequence
- MGGAHAERHFMGDMCENHMNKVILIGRLTKDPEIRYSSAAEPLAIARYTVAVNRRFRREGEPDADFINCVSFGKSAEFMEKYFKKGMSIGVVGRLSVRTYDDANGVRKWITEVLVEDQEFTESRNAFESRSSGAPREYAQPQKPSTSHSSQSFEPEGFSSILDNVDEEDLPF
Sample Types
Isolate
24.5%
Metagenome
71.9%
MAG
0.0%
Metatranscriptome
3.6%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
45.3%
Termitidae
30.7%
Blattidae
13.3%
Kalotermitidae
6.7%
Hodotermitidae
1.3%
Passalidae
1.3%
Termopsidae
1.3%
Taxonomy
Archaea
0
Bacteria
166
Eukaryota
0
Viruses
0
Unclassified
26
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 2 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 3 | 2820285501 | Unclassified Firmicutes Th196P3bin142 | Isolate | Unclassified |
| 4 | 2820435670 | Unclassified Firmicutes Lab288P3bin217 | Isolate | Unclassified |
| 5 | 2820495292 | Unclassified Firmicutes Lab288P1bin59 | Isolate | Unclassified |
| 6 | 2820602899 | Unclassified Firmicutes Emb289P1bin51 | Isolate | Unclassified |
| 7 | 2820698910 | Unclassified Firmicutes Co191P1bin64 | Isolate | Unclassified |
| 8 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 9 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 10 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 11 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 12 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 13 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 14 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 15 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 16 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 17 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 18 | 2820490862 | Unclassified Firmicutes Lab288P1bin64 | Isolate | Unclassified |
| 19 | 2820685979 | Unclassified Firmicutes Co191P1bin81 | Isolate | Unclassified |
| 20 | 2820696217 | Unclassified Firmicutes Co191P1bin66 | Isolate | Unclassified |
| 21 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 22 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 23 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 24 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 25 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 26 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 27 | 2820385248 | Unclassified Firmicutes Nt197P1bin19 | Isolate | Unclassified |
| 28 | 2820492969 | Unclassified Firmicutes Lab288P1bin6 | Isolate | Unclassified |
| 29 | 2820673891 | Unclassified Firmicutes Co191P3bin18 | Isolate | Unclassified |
| 30 | 2820676843 | Unclassified Firmicutes Co191P3bin17 | Isolate | Unclassified |
| 31 | 2820713307 | Unclassified Firmicutes Co191P1bin2 | Isolate | Unclassified |
| 32 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 33 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 34 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 35 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 36 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 37 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 38 | 2820329821 | Unclassified Firmicutes Nt197P3bin77 | Isolate | Unclassified |
| 39 | 2820382897 | Unclassified Firmicutes Nt197P1bin3 | Isolate | Unclassified |
| 40 | 2820627938 | Unclassified Firmicutes Emb289P1bin122 | Isolate | Unclassified |
| 41 | 2820693137 | Unclassified Firmicutes Co191P1bin70 | Isolate | Unclassified |
| 42 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 43 | 2820444930 | Unclassified Firmicutes Lab288P3bin199 | Isolate | Unclassified |
| 44 | 2820630457 | Unclassified Firmicutes Emb289P1bin119 | Isolate | Unclassified |
| 45 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 46 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 47 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 48 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
| 49 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 50 | 2820375548 | Unclassified Firmicutes Nt197P1bin8 | Isolate | Unclassified |
| 51 | 2820408893 | Unclassified Firmicutes Lab288P4bin80 | Isolate | Unclassified |
| 52 | 2820427814 | Unclassified Firmicutes Lab288P3bin44 | Isolate | Unclassified |
| 53 | 2820615445 | Unclassified Firmicutes Emb289P1bin132 | Isolate | Unclassified |
| 54 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 55 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 56 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 57 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 58 | 2820303403 | Unclassified Firmicutes Th196P1bin2 | Isolate | Unclassified |
| 59 | 2820522177 | Unclassified Firmicutes Lab288P1bin22 | Isolate | Unclassified |
| 60 | 2820541116 | Unclassified Firmicutes Lab288P1bin109 | Isolate | Unclassified |
| 61 | 2820581541 | Unclassified Firmicutes Emb289P3bin127 | Isolate | Unclassified |
| 62 | 2820644600 | Unclassified Firmicutes Cu122P5bin39 | Isolate | Unclassified |
| 63 | 2820654856 | Unclassified Firmicutes Cu122P1bin2 | Isolate | Unclassified |
| 64 | 2820702360 | Unclassified Firmicutes Co191P1bin4 | Isolate | Unclassified |
| 65 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 66 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 67 | 3300021245 | Termite gut microbial communities from nest from French Guiana - 11-4 mRNA SA | Metatranscriptome | Termitidae |
| 68 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 69 | 2820309449 | Unclassified Firmicutes Th196P1bin10 | Isolate | Unclassified |
| 70 | 2820380671 | Unclassified Firmicutes Nt197P1bin4 | Isolate | Unclassified |
| 71 | 2820607737 | Unclassified Firmicutes Emb289P1bin48 | Isolate | Unclassified |
| 72 | 2820663833 | Unclassified Firmicutes Co191P3bin41 | Isolate | Unclassified |
| 73 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 74 | 3300021231 | Termite gut microbial communities from nest - French Guiana - 10-1 mRNA SA | Metatranscriptome | Termitidae |
| 75 | 3300021238 | Termite gut microbial communities from nest - French Guiana - 6_6 mRNA SA | Metatranscriptome | Termitidae |
| 76 | 3300023282 | Termite gut microbial communities from Aparatermes sp. nest - French Guiana - 29-3 mRNA | Metatranscriptome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123355_10001573 | 3300009826 | Bacteria | 31869 |
| 2 | Ga0123355_10002463 | 3300009826 | Bacteria | 26188 |
| 3 | Ga0123355_10021162 | 3300009826 | Bacteria | 10407 |
| 4 | Ga0123355_10029788 | 3300009826 | Bacteria | 8842 |
| 5 | Ga0123355_10058343 | 3300009826 | Unclassified | 6243 |
| 6 | Ga0123355_10120955 | 3300009826 | Bacteria | 4062 |
| 7 | Ga0123355_10160695 | 3300009826 | Bacteria | 3385 |
| 8 | Ga0123355_10327781 | 3300009826 | Bacteria | 2055 |
| 9 | Ga0123356_10043917 | 3300010049 | Bacteria | 4161 |
| 10 | Ga0123356_10386360 | 3300010049 | Bacteria | 1534 |
| 11 | AustNasuHG_c1028381 | 3300000089 | Bacteria | 1673 |
| 12 | JGI24695J34938_10000022 | 3300002450 | Bacteria | 111549 |
| 13 | JGI24695J34938_10028482 | 3300002450 | Bacteria | 2625 |
| 14 | JGI24703J35330_11748608 | 3300002501 | Bacteria | 21865 |
| 15 | JGI24703J35330_11748632 | 3300002501 | Bacteria | 22829 |
| 16 | Ga0466704_095053 | 3300042643 | Bacteria | 13772 |
| 17 | Ga0466725_010827 | 3300042654 | Bacteria | 1847 |
| 18 | Ga0415639_068630 | 3300038395 | Bacteria | 1424 |
| 19 | Ga0415639_123594 | 3300038395 | Bacteria | 1305 |
| 20 | Ga0466700_485524 | 3300042600 | Bacteria | 4248 |
| 21 | Ga0123355_10000100 | 3300009826 | Bacteria | 93872 |
| 22 | Ga0123355_10001205 | 3300009826 | Bacteria | 36024 |
| 23 | Ga0123355_11377876 | 3300009826 | Unclassified | 699 |
| 24 | Ga0123356_11276596 | 3300010049 | Unclassified | 898 |
| 25 | Ga0123356_11414205 | 3300010049 | Bacteria | 856 |
| 26 | Ga0123353_10407706 | 3300010167 | Unclassified | 2020 |
| 27 | Ga0466726_094267 | 3300042619 | Bacteria | 2254 |
| 28 | JGI24695J34938_10000084 | 3300002450 | Bacteria | 81094 |
| 29 | JGI24700J35501_10930514 | 3300002508 | Bacteria | 14927 |
| 30 | Ga0466725_144083 | 3300042654 | Bacteria | 1530 |
| 31 | Ga0223682_1011545 | 3300021231 | Bacteria | 1149 |
| 32 | Ga0415639_094024 | 3300038395 | Bacteria | 4738 |
| 33 | Ga0466693_330652 | 3300042592 | Unclassified | 1444 |
| 34 | Ga0466714_146874 | 3300042603 | Bacteria | 1299 |
| 35 | Ga0466719_029791 | 3300042606 | Bacteria | 1099 |
| 36 | Ga0123355_10001084 | 3300009826 | Bacteria | 37608 |
| 37 | Ga0123355_10004072 | 3300009826 | Bacteria | 21191 |
| 38 | Ga0123355_10043070 | 3300009826 | Bacteria | 7345 |
| 39 | Ga0123355_10077758 | 3300009826 | Bacteria | 5304 |
| 40 | Ga0123355_10124492 | 3300009826 | Bacteria | 3988 |
| 41 | Ga0123355_10146084 | 3300009826 | Unclassified | 3606 |
| 42 | Ga0123355_10253172 | 3300009826 | Bacteria | 2475 |
| 43 | Ga0123355_10541917 | 3300009826 | Bacteria | 1412 |
| 44 | Ga0123355_10648218 | 3300009826 | Bacteria | 1233 |
| 45 | Ga0123355_11606834 | 3300009826 | Unclassified | 626 |
| 46 | Ga0123356_10209488 | 3300010049 | Bacteria | 1996 |
| 47 | Ga0123353_10046467 | 3300010167 | Bacteria | 6900 |
| 48 | Ga0123353_11038834 | 3300010167 | Bacteria | 1096 |
| 49 | JGI24695J34938_10001096 | 3300002450 | Unclassified | 24433 |
| 50 | Ga0466725_286300 | 3300042654 | Bacteria | 2623 |
| 51 | Ga0415639_026962 | 3300038395 | Bacteria | 5941 |
| 52 | Ga0415639_074247 | 3300038395 | Unclassified | 1075 |
| 53 | Ga0466714_073428 | 3300042603 | Bacteria | 3149 |
| 54 | Ga0466733_048938 | 3300042659 | Bacteria | 4354 |
| 55 | Ga0123355_10002512 | 3300009826 | Bacteria | 25983 |
| 56 | Ga0123355_10005927 | 3300009826 | Bacteria | 18004 |
| 57 | Ga0123355_10014990 | 3300009826 | Bacteria | 12154 |
| 58 | Ga0123355_10015124 | 3300009826 | Bacteria | 12109 |
| 59 | Ga0123355_10083896 | 3300009826 | Bacteria | 5077 |
| 60 | Ga0123355_10229676 | 3300009826 | Bacteria | 2652 |
| 61 | Ga0123355_10245560 | 3300009826 | Unclassified | 2528 |
| 62 | Ga0123355_10355500 | 3300009826 | Unclassified | 1936 |
| 63 | Ga0123355_10696623 | 3300009826 | Bacteria | 1168 |
| 64 | Ga0123355_11041048 | 3300009826 | Bacteria | 862 |
| 65 | Ga0123355_11133315 | 3300009826 | Unclassified | 809 |
| 66 | Ga0123355_11988441 | 3300009826 | Unclassified | 539 |
| 67 | Ga0123353_10000051 | 3300010167 | Bacteria | 130638 |
| 68 | Ga0123353_10140900 | 3300010167 | Bacteria | 3862 |
| 69 | Ga0123353_10332917 | 3300010167 | Bacteria | 2297 |
| 70 | Ga0123353_10592084 | 3300010167 | Bacteria | 1588 |
| 71 | Ga0466715_183088 | 3300042616 | Bacteria | 24090 |
| 72 | JGI24703J35330_11748655 | 3300002501 | Bacteria | 23777 |
| 73 | Ga0072941_1755282 | 3300005201 | Bacteria | 1051 |
| 74 | Ga0466725_248015 | 3300042654 | Bacteria | 16697 |
| 75 | Ga0223681_1030439 | 3300021238 | Bacteria | 770 |
| 76 | Ga0255808_1006952 | 3300023282 | Bacteria | 635 |
| 77 | Ga0415639_029134 | 3300038395 | Bacteria | 2795 |
| 78 | Ga0466693_444600 | 3300042592 | Bacteria | 1308 |
| 79 | Ga0466699_055086 | 3300042597 | Bacteria | 4801 |
| 80 | Ga0466700_032379 | 3300042600 | Bacteria | 1067 |
| 81 | Ga0466733_135542 | 3300042659 | Bacteria | 1809 |
| 82 | Ga0123355_10001625 | 3300009826 | Bacteria | 31375 |
| 83 | Ga0123355_10005741 | 3300009826 | Bacteria | 18239 |
| 84 | Ga0123355_10014214 | 3300009826 | Bacteria | 12435 |
| 85 | Ga0123355_10242716 | 3300009826 | Bacteria | 2549 |
| 86 | Ga0123355_10271418 | 3300009826 | Bacteria | 2356 |
| 87 | Ga0123355_10573648 | 3300009826 | Bacteria | 1352 |
| 88 | Ga0123355_10775593 | 3300009826 | Bacteria | 1076 |
| 89 | Ga0123353_10023718 | 3300010167 | Bacteria | 9295 |
| 90 | Ga0123354_10005741 | 3300010882 | Bacteria | 18168 |
| 91 | Ga0466705_429319 | 3300042612 | Bacteria | 3513 |
| 92 | Ga0466711_339146 | 3300042615 | Unclassified | 6774 |
| 93 | JGI24703J35330_11747645 | 3300002501 | Bacteria | 7578 |
| 94 | JGI24700J35501_10930457 | 3300002508 | Bacteria | 14352 |
| 95 | Ga0466724_36645 | 3300042649 | Bacteria | 2826 |
| 96 | Ga0223683_1026946 | 3300021245 | Unclassified | 679 |
| 97 | Ga0233288_1102088 | 3300022232 | Unclassified | 708 |
| 98 | Ga0466714_061628 | 3300042603 | Bacteria | 29345 |
| 99 | Ga0466719_545247 | 3300042606 | Unclassified | 1151 |
| 100 | Ga0123355_10000488 | 3300009826 | Bacteria | 52648 |
| 101 | Ga0123355_10002556 | 3300009826 | Unclassified | 25789 |
| 102 | Ga0123355_10012764 | 3300009826 | Bacteria | 13029 |
| 103 | Ga0123355_10034792 | 3300009826 | Bacteria | 8188 |
| 104 | Ga0123355_10186165 | 3300009826 | Unclassified | 3069 |
| 105 | Ga0123355_10203514 | 3300009826 | Bacteria | 2886 |
| 106 | Ga0123355_11074781 | 3300009826 | Unclassified | 841 |
| 107 | Ga0123354_10613444 | 3300010882 | Bacteria | 792 |
| 108 | 2227164138 | 2225789004 | Bacteria | 35303 |
| 109 | JGI24695J34938_10000615 | 3300002450 | Bacteria | 33930 |
| 110 | Ga0466725_355492 | 3300042654 | Bacteria | 1166 |
| 111 | Ga0466693_310163 | 3300042592 | Unclassified | 2717 |
| 112 | Ga0466706_037907 | 3300042599 | Bacteria | 5430 |
| 113 | Ga0466700_012539 | 3300042600 | Bacteria | 1501 |
| 114 | Ga0466714_042329 | 3300042603 | Bacteria | 15805 |
| 115 | Ga0466721_078506 | 3300042608 | Bacteria | 1873 |
| 116 | Ga0466705_310521 | 3300042612 | Bacteria | 78321 |
| 117 | Ga0466733_004043 | 3300042659 | Bacteria | 7866 |
| 118 | Ga0123355_10001707 | 3300009826 | Bacteria | 30570 |
| 119 | Ga0123355_10044927 | 3300009826 | Unclassified | 7186 |
| 120 | Ga0123355_10255848 | 3300009826 | Bacteria | 2457 |
| 121 | Ga0123355_10470290 | 3300009826 | Bacteria | 1571 |
| 122 | Ga0123355_10533254 | 3300009826 | Bacteria | 1429 |
| 123 | Ga0123355_10659875 | 3300009826 | Unclassified | 1217 |
| 124 | Ga0123355_10835625 | 3300009826 | Bacteria | 1017 |
| 125 | Ga0123353_11276701 | 3300010167 | Bacteria | 956 |
| 126 | Ga0466726_436046 | 3300042619 | Bacteria | 2401 |
| 127 | Ga0233288_1051910 | 3300022232 | Bacteria | 1096 |
| 128 | Ga0415639_008662 | 3300038395 | Bacteria | 14679 |
| 129 | Ga0466693_406311 | 3300042592 | Bacteria | 5045 |
| 130 | Ga0466706_032906 | 3300042599 | Unclassified | 3255 |
| 131 | Ga0123355_10002253 | 3300009826 | Bacteria | 27216 |
| 132 | Ga0123355_10007548 | 3300009826 | Bacteria | 16318 |
| 133 | Ga0123355_10452555 | 3300009826 | Bacteria | 1617 |
| 134 | Ga0123355_10498268 | 3300009826 | Bacteria | 1504 |
| 135 | Ga0123355_10509673 | 3300009826 | Bacteria | 1479 |
| 136 | Ga0123355_10569705 | 3300009826 | Bacteria | 1359 |
| 137 | Ga0123355_11517633 | 3300009826 | Unclassified | 652 |
| 138 | Ga0123356_11500687 | 3300010049 | Unclassified | 832 |
| 139 | Ga0123353_10014686 | 3300010167 | Bacteria | 11309 |
| 140 | Ga0233288_1025073 | 3300022232 | Bacteria | 1423 |
| 141 | Ga0415639_002733 | 3300038395 | Bacteria | 94318 |
| 142 | Ga0415639_067705 | 3300038395 | Bacteria | 2446 |
| 143 | Ga0466706_114772 | 3300042599 | Bacteria | 128005 |
| 144 | Ga0466714_022372 | 3300042603 | Bacteria | 6115 |
| 145 | Ga0466717_026436 | 3300042604 | Bacteria | 1983 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00436 | SSB | Single-strand binding protein family | 19 | 120 | 0.94 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00436 | GO:0003697 | single-stranded DNA binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.