Protein Family IF07687
Metagenome
Isolate
145
Members
50
Samples
132
Scaffolds
319.39
Avg Length
Representative Sequence
- ID
- 3300042616|Ga0466715_175784|Ga0466715_175784_2494_3504
- Length
- 299 aa
- Sequence
- LRTHDPLFWEDARRAEVQMKTVRSLKKWIDLYKVVHDAAEELDLTFEYAKEGIASELEFRNMLREEADQMSCVLKINSGAGGTESQDWALMLMRMYMRWSESNGYKVGDYAYGYLKGENGVHRLVRVSPYNAQGKRMTSFASVFVAPLVDDTIEINIIPANISWDTFRSSGAGGQNVNKVESGVRLRYRYKDPYTGQEEEILIENTETRDQPKNRDNAMRHLRSILYDKEMQHRLAEKAKIESGKMKIEWGSQIRSYVFDDRRVKDHRTNYQTSDVNGVMDGKIDAFIKAYLMEFSESR
Sample Types
Isolate
9.0%
Metagenome
91.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
28.0%
Blattidae
26.0%
Termitidae
22.0%
Termopsidae
6.0%
Rhinotermitidae
6.0%
Unclassified
6.0%
Passalidae
4.0%
Hodotermitidae
2.0%
Taxonomy
Archaea
0
Bacteria
132
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 11 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 12 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 13 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 14 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 15 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 16 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 17 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 18 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 19 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 20 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 21 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 22 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 23 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 24 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 25 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 26 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 27 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 28 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 29 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 30 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 31 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 32 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 33 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 34 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 35 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 36 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 37 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 38 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 39 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 40 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 41 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 42 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 43 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 44 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 45 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 46 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 47 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 48 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 49 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 50 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466691_039935 | 3300042593 | Bacteria | 25425 |
| 2 | Ga0466713_043321 | 3300042602 | Bacteria | 21588 |
| 3 | Ga0466713_119544 | 3300042602 | Unclassified | 3639 |
| 4 | Ga0466716_098196 | 3300042605 | Bacteria | 11814 |
| 5 | Ga0466716_185707 | 3300042605 | Unclassified | 9282 |
| 6 | Ga0466722_009947 | 3300042609 | Bacteria | 58351 |
| 7 | 2227546571 | 2225789004 | Bacteria | 2911 |
| 8 | IMNBL1DRAFT_c0002120 | 3300000062 | Bacteria | 14126 |
| 9 | Ga0466711_002552 | 3300042615 | Unclassified | 1169 |
| 10 | Ga0466715_175784 | 3300042616 | Bacteria | 6488 |
| 11 | Ga0466723_298572 | 3300042618 | Bacteria | 9528 |
| 12 | Ga0466728_152411 | 3300042620 | Bacteria | 4546 |
| 13 | Ga0466728_234738 | 3300042620 | Bacteria | 7792 |
| 14 | Ga0466703_197495 | 3300042636 | Bacteria | 27336 |
| 15 | Ga0466704_037147 | 3300042643 | Unclassified | 1171 |
| 16 | Ga0466708_253802 | 3300042652 | Bacteria | 20440 |
| 17 | Ga0466708_307162 | 3300042652 | Bacteria | 42833 |
| 18 | Ga0466708_467274 | 3300042652 | Bacteria | 20579 |
| 19 | Ga0466727_016314 | 3300042655 | Bacteria | 12921 |
| 20 | Ga0466727_296297 | 3300042655 | Bacteria | 3624 |
| 21 | Ga0466692_055749 | 3300042591 | Bacteria | 10956 |
| 22 | Ga0466696_068302 | 3300042596 | Bacteria | 6787 |
| 23 | Ga0466701_045678 | 3300042598 | Bacteria | 7095 |
| 24 | Ga0466706_268163 | 3300042599 | Bacteria | 17265 |
| 25 | Ga0466713_063902 | 3300042602 | Bacteria | 5038 |
| 26 | 2227352990 | 2225789004 | Bacteria | 6165 |
| 27 | IMNBL1DRAFT_c0009643 | 3300000062 | Bacteria | 4739 |
| 28 | JGI24702J35022_10002906 | 3300002462 | Bacteria | 10370 |
| 29 | Ga0466705_401719 | 3300042612 | Bacteria | 3873 |
| 30 | Ga0466705_496225 | 3300042612 | Bacteria | 1817 |
| 31 | Ga0466703_170741 | 3300042636 | Bacteria | 15598 |
| 32 | Ga0466703_322389 | 3300042636 | Bacteria | 2998 |
| 33 | Ga0466727_156556 | 3300042655 | Bacteria | 4338 |
| 34 | Ga0466692_100322 | 3300042591 | Bacteria | 97018 |
| 35 | Ga0466696_278334 | 3300042596 | Bacteria | 2039 |
| 36 | Ga0466696_459997 | 3300042596 | Bacteria | 6563 |
| 37 | Ga0466707_067819 | 3300042601 | Bacteria | 13397 |
| 38 | Ga0466716_257364 | 3300042605 | Bacteria | 5972 |
| 39 | Ga0466719_336229 | 3300042606 | Unclassified | 1459 |
| 40 | Ga0466705_125588 | 3300042612 | Bacteria | 27996 |
| 41 | Ga0466733_103492 | 3300042659 | Bacteria | 19163 |
| 42 | JGI24702J35022_10002126 | 3300002462 | Bacteria | 12233 |
| 43 | JGI24705J35276_12230949 | 3300002504 | Bacteria | 3781 |
| 44 | Ga0068305_10043964 | 3300005083 | Bacteria | 7034 |
| 45 | Ga0466711_038761 | 3300042615 | Bacteria | 10433 |
| 46 | Ga0466711_083363 | 3300042615 | Bacteria | 2233 |
| 47 | Ga0466711_084189 | 3300042615 | Bacteria | 14152 |
| 48 | Ga0466711_424279 | 3300042615 | Bacteria | 19107 |
| 49 | Ga0466715_278824 | 3300042616 | Bacteria | 18319 |
| 50 | Ga0466726_153120 | 3300042619 | Unclassified | 3864 |
| 51 | Ga0466728_234478 | 3300042620 | Bacteria | 23263 |
| 52 | Ga0466703_135301 | 3300042636 | Bacteria | 13728 |
| 53 | Ga0466704_228618 | 3300042643 | Bacteria | 3689 |
| 54 | Ga0466727_003774 | 3300042655 | Bacteria | 5542 |
| 55 | Ga0466727_113211 | 3300042655 | Bacteria | 1786 |
| 56 | Ga0466690_431410 | 3300042590 | Bacteria | 3045 |
| 57 | Ga0466691_175180 | 3300042593 | Bacteria | 5779 |
| 58 | Ga0466696_487591 | 3300042596 | Bacteria | 13782 |
| 59 | Ga0466707_018618 | 3300042601 | Bacteria | 7821 |
| 60 | Ga0466716_109881 | 3300042605 | Bacteria | 5466 |
| 61 | Ga0068302_10041588 | 3300005071 | Bacteria | 2064 |
| 62 | Ga0068305_10038655 | 3300005083 | Unclassified | 3002 |
| 63 | Ga0466711_175432 | 3300042615 | Bacteria | 3451 |
| 64 | Ga0466711_254092 | 3300042615 | Bacteria | 3400 |
| 65 | Ga0466718_033122 | 3300042617 | Bacteria | 1300 |
| 66 | Ga0466728_106361 | 3300042620 | Bacteria | 7488 |
| 67 | Ga0466728_230152 | 3300042620 | Unclassified | 6092 |
| 68 | Ga0466703_208093 | 3300042636 | Bacteria | 6793 |
| 69 | Ga0466717_266981 | 3300042604 | Bacteria | 2128 |
| 70 | Ga0466719_425727 | 3300042606 | Bacteria | 5941 |
| 71 | Ga0466697_083590 | 3300042611 | Bacteria | 2197 |
| 72 | Ga0466705_046601 | 3300042612 | Bacteria | 5769 |
| 73 | Ga0466705_387301 | 3300042612 | Unclassified | 17093 |
| 74 | Ga0466733_059268 | 3300042659 | Bacteria | 25661 |
| 75 | Ga0466711_155160 | 3300042615 | Bacteria | 11303 |
| 76 | Ga0466715_109224 | 3300042616 | Bacteria | 75833 |
| 77 | Ga0466715_349362 | 3300042616 | Bacteria | 5872 |
| 78 | Ga0466723_066623 | 3300042618 | Unclassified | 5143 |
| 79 | Ga0466726_042905 | 3300042619 | Bacteria | 14115 |
| 80 | Ga0466726_403927 | 3300042619 | Bacteria | 4174 |
| 81 | Ga0466728_169008 | 3300042620 | Bacteria | 25778 |
| 82 | Ga0466731_237977 | 3300042622 | Bacteria | 7293 |
| 83 | Ga0466703_290124 | 3300042636 | Bacteria | 8320 |
| 84 | Ga0466708_099406 | 3300042652 | Bacteria | 14004 |
| 85 | Ga0466725_297904 | 3300042654 | Bacteria | 14838 |
| 86 | Ga0466690_404125 | 3300042590 | Bacteria | 3136 |
| 87 | Ga0466696_005035 | 3300042596 | Bacteria | 32427 |
| 88 | Ga0466696_097978 | 3300042596 | Bacteria | 14664 |
| 89 | Ga0466696_236668 | 3300042596 | Bacteria | 4954 |
| 90 | Ga0466706_168047 | 3300042599 | Bacteria | 9503 |
| 91 | Ga0466707_019140 | 3300042601 | Unclassified | 1654 |
| 92 | Ga0466707_371795 | 3300042601 | Bacteria | 7931 |
| 93 | Ga0466714_153181 | 3300042603 | Bacteria | 120481 |
| 94 | JGI24702J35022_10018287 | 3300002462 | Bacteria | 3824 |
| 95 | JGI24702J35022_10021861 | 3300002462 | Bacteria | 3466 |
| 96 | Ga0068302_10222719 | 3300005071 | Bacteria | 2315 |
| 97 | Ga0466711_143457 | 3300042615 | Bacteria | 5135 |
| 98 | Ga0466715_030319 | 3300042616 | Bacteria | 43703 |
| 99 | Ga0466715_485052 | 3300042616 | Bacteria | 31199 |
| 100 | Ga0466731_009211 | 3300042622 | Bacteria | 1271 |
| 101 | Ga0466703_214731 | 3300042636 | Bacteria | 22711 |
| 102 | Ga0466704_358678 | 3300042643 | Unclassified | 6236 |
| 103 | Ga0466704_378891 | 3300042643 | Bacteria | 31782 |
| 104 | Ga0466709_146820 | 3300042648 | Bacteria | 2179 |
| 105 | Ga0466709_160051 | 3300042648 | Bacteria | 4641 |
| 106 | Ga0466727_228012 | 3300042655 | Bacteria | 1989 |
| 107 | Ga0466690_409563 | 3300042590 | Bacteria | 30321 |
| 108 | Ga0466716_114211 | 3300042605 | Bacteria | 30877 |
| 109 | Ga0466716_129240 | 3300042605 | Bacteria | 11148 |
| 110 | Ga0466722_228933 | 3300042609 | Bacteria | 8341 |
| 111 | Ga0466705_201614 | 3300042612 | Bacteria | 1520 |
| 112 | Ga0466711_037934 | 3300042615 | Bacteria | 4226 |
| 113 | Ga0466711_434385 | 3300042615 | Bacteria | 7629 |
| 114 | Ga0466715_301112 | 3300042616 | Bacteria | 4887 |
| 115 | Ga0466715_579190 | 3300042616 | Bacteria | 2131 |
| 116 | Ga0466723_080576 | 3300042618 | Bacteria | 15425 |
| 117 | Ga0466723_082277 | 3300042618 | Bacteria | 15970 |
| 118 | Ga0466704_251609 | 3300042643 | Bacteria | 45182 |
| 119 | Ga0466725_164174 | 3300042654 | Bacteria | 16518 |
| 120 | Ga0466727_022134 | 3300042655 | Bacteria | 16946 |
| 121 | Ga0123354_10185626 | 3300010882 | Bacteria | 2354 |
| 122 | Ga0466691_059224 | 3300042593 | Bacteria | 7239 |
| 123 | Ga0466713_003458 | 3300042602 | Bacteria | 44331 |
| 124 | Ga0466713_114043 | 3300042602 | Bacteria | 6718 |
| 125 | Ga0466719_049009 | 3300042606 | Unclassified | 4568 |
| 126 | 2227519075 | 2225789004 | Bacteria | 17420 |
| 127 | IMNBL1DRAFT_c0001903 | 3300000062 | Bacteria | 15106 |
| 128 | Ga0466705_400956 | 3300042612 | Bacteria | 24773 |
| 129 | Ga0466711_287226 | 3300042615 | Bacteria | 2057 |
| 130 | Ga0466723_254019 | 3300042618 | Bacteria | 22293 |
| 131 | Ga0466729_158359 | 3300042621 | Bacteria | 24114 |
| 132 | Ga0466703_029931 | 3300042636 | Bacteria | 2898 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF03462 | GO:0006415 | translational termination | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.